KEGG   Thermincola potens: TherJR_1161Help
Entry
TherJR_1161       CDS       T01226                                 

Definition
(GenBank) dihydropteroate synthase DHPS
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
tjr  Thermincola potens
Pathway
tjr00720  Carbon fixation pathways in prokaryotes
tjr01100  Metabolic pathways
tjr01120  Microbial metabolism in diverse environments
tjr01200  Carbon metabolism
Module
tjr_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
tjr_M00618  Acetogen
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TherJR_1161
Enzymes [BR:tjr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     TherJR_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: ADG82025
UniProt: D5XEF4
Position
1235771..1236568
Genome map
AA seq 265 aa AA seqDB search
MFEIIGERINGLFTDIREAIANKDPKPIQQWAVKQAEKGAAWLDINTGPISSKEEQAEVM
EWLVKTAQEAVDLPCAIDTTNPLAMEAGLKVHKGKAMINSTTAEQAKMEVFFPMAAKYNA
ALVALAMNEKGVPKSAEDRTALAMELVAMADAYGIPFQDLYIDPLVLPVNVAQEHAPEAL
EALRQVKLLSNPAPKTTVGLSNISQKAPNRPLINRTFLAMAMVCGLDSAIMDADDDDLVD
TAATASIILNQSIYCDSYLKIFRQK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaattatcggtgaaagaattaacggtcttttcacagacattcgtgaggccatt
gccaacaaagacccgaaacctattcagcagtgggctgtaaagcaggctgagaagggcgct
gcctggttggacattaatactgggcctatttccagtaaagaggaacaagctgaagtaatg
gaatggttagtaaagaccgcccaggaagccgttgaccttccctgtgctatcgatactacc
aaccccttggctatggaagcagggctcaaggttcataagggtaaagccatgattaactcc
acaacggcagaacaagctaaaatggaagtattctttcccatggcagccaaatataatgcg
gctctggtagccctggccatgaatgagaaaggcgttcccaagagcgctgaagaccgtaca
gcgctcgcaatggaattagttgctatggctgatgcatacggcatacccttccaggatctt
tacatagatccccttgtattgcctgtaaacgttgctcaggagcacgctccggaagctttg
gaggctctccgccaggttaagcttctctccaatccggctcccaaaaccaccgttggtttg
agcaacatttcccagaaggctcctaaccgtccgctgatcaaccgtaccttcctggctatg
gcaatggtttgcggtttggattccgctattatggatgctgatgatgatgacctggtagat
accgcagctactgccagtatcattctgaatcagtctatttactgtgattcctacctcaag
atatttagacagaaatag

DBGET integrated database retrieval system