KEGG   Thermincola potens: TherJR_2074
Entry
TherJR_2074       CDS       T01226                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
tjr  Thermincola potens
Pathway
tjr00061  Fatty acid biosynthesis
tjr00780  Biotin metabolism
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01212  Fatty acid metabolism
tjr01240  Biosynthesis of cofactors
Module
tjr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TherJR_2074
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TherJR_2074
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TherJR_2074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tjr01004]
    TherJR_2074
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     TherJR_2074
Lipid biosynthesis proteins [BR:tjr01004]
 Fatty acid synthase
  Component type
   TherJR_2074
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase CHASE2 3HCDH_N 3Beta_HSD AdoHcyase_NAD
Other DBs
NCBI-ProteinID: ADG82919
UniProt: D5X8P3
Position
complement(2139171..2139914)
AA seq 247 aa
MVLRDKIAIVTGGSRGIGKAICEALARQGARVVIFDVNAAELQNCVTELKAAGFDAEGYE
VNVAQADKVEEAVAGVIDNLGRIDILVNNAGITRDTLLMRMKEEDWDAVLAVNLKGVFNC
TKAVSRPMMKQRSGVIINISSVVGLMGNAGQANYAASKAGIIGFTKSVARELASRGVRAN
AIAPGFIVTQMTDVLSDEIKGELQKQIPLGRLGQPEDVANLVVFLASDNASYITGQTIAV
DGGMVMH
NT seq 744 nt   +upstreamnt  +downstreamnt
atggttctaagggataaaattgccatagtaacgggcgggtcccgtgggattggcaaggcc
atatgtgaagccctggcccgacagggagcgcgtgttgtcatttttgacgtaaatgccgca
gaactgcagaattgtgttacggaattaaaggctgccggttttgatgccgaaggctacgaa
gttaacgtagctcaggccgataaagttgaggaggcagtggccggggtgatagacaattta
gggcgtattgatattttggtgaataatgcaggtatcacccgagacacactgttaatgcgg
atgaaggaagaagattgggatgccgtattggcagtgaacctaaagggtgtttttaactgt
acaaaggcagttagccgccccatgatgaagcagcgcagtggggtgatcatcaacatctct
tccgttgtcggtttaatgggtaatgcaggccaggccaactatgcggcttccaaggccggg
atcattggctttaccaagtcagtggcccgtgagttggcgtcaagaggggtaagggctaat
gccattgcgcccggatttattgttacgcaaatgacggatgtcctttccgacgaaataaaa
ggggaactgcagaagcagattccgctgggcaggctgggacaaccggaagatgtagccaat
ctggttgtttttctggcttctgacaatgccagttatattactgggcagaccatcgctgtt
gatggcgggatggtaatgcactaa

DBGET integrated database retrieval system