KEGG   Thermincola potens: TherJR_2183Help
Entry
TherJR_2183       CDS       T01226                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
tjr  Thermincola potens
Pathway
tjr00051  Fructose and mannose metabolism
tjr00520  Amino sugar and nucleotide sugar metabolism
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TherJR_2183
   00520 Amino sugar and nucleotide sugar metabolism
    TherJR_2183
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     TherJR_2183
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     TherJR_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep NTP_transf_3 Hexapep_2 PGM_PMM_III PGM_PMM_IV IspD
Motif
Other DBs
NCBI-ProteinID: ADG83026
UniProt: D5X9C2
Position
complement(2255166..2257586)
Genome map
AA seq 806 aa AA seqDB search
MKAVIMAGGQGSRLRPLTCNKPKPMVPVLNKPVMEYAIELLRKHGITEIAVTLQYLPDKI
KEYFGDGSRYGVQLHYFEETIPLGTAGSVRNAAEFLDETFLVISGDGITDYDLTKAVAYH
KEKKGIVTLVLAKVANPLEYGVVMCDDSGKIIRFLEKPSWGEVFSDTVNTGIYVIEPEIF
NYFDKDIFFDFSKDLFPLLMEKGRELYGYIATGYWSDIGSLEQYRQTHFDLLDGLVNVPL
KVRMVEDGLWIGENTEIHPGVKFTGRPVYIGDNCYIDQDVELGEYTIIGNNNTIRNKASI
KRSILWDYNYIDQNVELRGAVVCHHNRVQSNTSVFEGAVIGDDCFLGNRVMIKPQVKLWP
EKIVEDNSVVNTSLIWSDVYRRNLFAYNGISGIVNVEVTPDMAVKLALAYGASIPVNTRV
VVGSDYHSASQVMKKAIKAGLLAAGITVHDIGICRTPVSRFAVKQLAAKGGLHIRMLPPV
ANHKILIEILDENGINIGKDVERKIENAFYQEDFRRAIPRQLGEIRYMTGLCDGYIDTML
QSVAVEQIRARRYKVLLAYDSKNTNCSLPEVLEKLGCRLTTVHFEDYSPESLSSLVLQNS
MDLAIYLNSNADLAVFISDDGQVITDENLLCLWTYIVFKSGQSRMLGVPITAPSIIERIA
EQYNGEIVRTRANPRAMMEVTKDSLFQPYFDGVYMGIKLIEFLAMQNKKLSEVLRAIPQP
HLHKQLVQCPWGAKGTVMRRLIEEIKGEQVELIDGIKIYHKNGWALILPDHEEPVFRVLS
EANNDKTAEEIAATYAHKIENYRSAI
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttattatggctggggggcagggctcgcggctgaggccgctgacctgcaac
aaacccaaaccgatggtgccggtactgaacaagccggtgatggagtatgccatcgaatta
ctaaggaagcacgggattacggagatagccgtcacactgcaatacctgccggataaaatc
aaagaatattttggcgatggttcacgatacggagttcaactgcattactttgaggagacc
attccgctgggaacggcaggaagcgtgagaaatgccgctgaatttcttgacgaaaccttt
ttggttatcagcggcgacggtataactgattatgacttgaccaaagctgttgcttaccat
aaagagaaaaagggcatcgtcactctggtcctggctaaggtggcaaaccctctggaatac
ggggtagtaatgtgcgatgatagtgggaaaattatccgcttcctggaaaaacccagttgg
ggggaagtattcagtgacacggtaaacacaggaatttatgtcattgagccggaaattttc
aattactttgataaagatattttctttgacttcagtaaagacctgtttccgctgttgatg
gaaaaaggcagagaactttatgggtatattgccacgggttactggtcagatataggaagc
ctggaacagtaccggcagactcatttcgatttgctggacggtctggtaaatgtgccgctg
aaagtgcgcatggtggaagatggtttatggatcggtgaaaacacggaaatccatcctggc
gtaaaatttaccgggcgcccagtttatataggcgataactgttatatagaccaggatgtg
gaactgggagagtataccataatcggaaacaataatactattaggaataaagcttctatc
aaaagaagtattctttgggattacaattatattgaccaaaatgtggaactcagaggcgcg
gtagtatgccatcataacagggtgcagtccaacacctcagtatttgaaggggcagtgatt
ggagacgattgtttcttgggtaacagggtcatgattaaaccccaggtgaaattatggccg
gaaaaaattgtggaagacaactcggtggtaaatacttcattgatttggagtgacgtatac
agacgtaacctgtttgcgtacaacggcatcagcggtattgttaacgttgaggttacaccg
gatatggcagttaaactggctttagcttacggggcgtccataccggtgaacaccagggta
gtcgtagggtcagattatcactcggcttcacaggttatgaagaaggccattaaagccggt
ctcctggctgcagggattacagtgcatgatatcggcatctgccggacgccggtcagtagg
tttgccgttaagcaattggcggccaaaggaggattgcatatccggatgctcccgcccgtt
gccaaccataaaattctcatagaaatcctggacgaaaacggcatcaatatcggcaaggat
gttgagcggaaaatcgaaaatgctttttaccaggaagatttccgccgggcaattccccga
cagttaggggaaataagatacatgaccggattgtgcgacggttacatagatacaatgttg
caaagtgtagcggtagaacagatcagggcacgccggtacaaagtattgctggcctatgac
agtaaaaacaccaactgctccctgccggaagtgttggaaaaactgggctgccggttaaca
accgtgcatttcgaggattattctccggaaagtctgtcgtccctggtcctgcaaaatagc
atggatttggccatttacctgaacagtaatgccgatctggctgtcttcataagtgatgac
ggacaggttatcactgatgagaatctgctgtgcttgtggacctacattgtttttaaatcg
gggcagagcaggatgttgggtgttcccataacggcgccttcgattattgaacgcattgcg
gaacaatataacggtgaaatagttcgtaccagggccaacccccgtgccatgatggaagtt
accaaggacagtctctttcagccttattttgacggggtatatatgggtatcaagttgatt
gagtttctggccatgcagaataaaaaactttctgaagtactacgggccattccgcagccg
cacctgcataagcagttggtgcagtgcccgtggggagccaaaggcacggttatgcgccgt
ttaatagaagagattaaaggggagcaagtggagttgatagatggcattaaaatttatcac
aaaaacggctgggccttgattctgcccgaccacgaggaaccggtgttccgggtgctaagc
gaggcaaacaatgataagaccgcagaagagattgccgcaacttatgcccataaaatcgaa
aactaccggtcggcgatttaa

DBGET integrated database retrieval system