KEGG   Thermincola potens: TherJR_2671Help
Entry
TherJR_2671       CDS       T01226                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tjr  Thermincola potens
Pathway
tjr00040  Pentose and glucuronate interconversions
tjr00052  Galactose metabolism
tjr00500  Starch and sucrose metabolism
tjr00520  Amino sugar and nucleotide sugar metabolism
tjr01100  Metabolic pathways
tjr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TherJR_2671
   00052 Galactose metabolism
    TherJR_2671
   00500 Starch and sucrose metabolism
    TherJR_2671
   00520 Amino sugar and nucleotide sugar metabolism
    TherJR_2671
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TherJR_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADG83506
UniProt: D5XC54
Position
complement(2777150..2778034)
Genome map
AA seq 294 aa AA seqDB search
MKKIRKAVIPAGGWGTRCLPASKAIPKEMLPIVDKPAIHYVVEEAVAAGITDILIITGRN
KDCIADYFDRNLELETFLEIKGKNELLQKVRHPAGLVNIYYTRQKEQKGLGHAVSLAREF
VGREPFAVLLPDDLIDTKVPCLKQMVDMYERRPGTTVAVMEVPREEVKNYGIIKPVRLTA
NVFVIRDLVEKPAVNKAPSNLAIVGRYIIEPEVFACLDKVEPGAGGEIQLTDALRMLLEK
DELYAYKFFGNRYDVGNIAGFVRANIQLGLNHPELGSVIEKEIMGILDNRLKVG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatccggaaagcggttattcctgcaggggggtggggtaccaggtgccttccg
gcttccaaggccatcccgaaagaaatgctgcccattgtggataaaccggctattcattac
gttgttgaagaagccgttgcggctggcataaccgatatcctgattataacgggacggaat
aaagattgtattgcggattattttgaccgcaatttggaattggaaaccttcctggaaatt
aaggggaaaaacgaattgctacagaaagtccggcaccccgcgggcctggtaaatatttat
tatacccggcagaaggaacaaaagggtctgggccatgcggtgtctttagccagggaattt
gtgggacgcgaaccctttgctgtcctgctacccgatgatttaattgataccaaggtgccc
tgtttgaagcagatggttgatatgtatgaaaggcggcccggcacaaccgttgcagtaatg
gaagttccgcgtgaagaagtaaaaaattacggtattatcaaaccggtacgcctgacggcc
aatgtctttgtcattagggacctggtggaaaagccggccgtaaacaaagcaccgtcaaac
ctggctattgtagggcggtacataattgagccagaggtttttgcatgccttgataaagtc
gaaccgggggccggcggtgagatacagttgaccgatgccttgagaatgctgttagaaaaa
gatgaattgtatgcctataaatttttcgggaacaggtatgatgttggcaatattgccggc
tttgtccgggccaacatccaactggggttaaatcaccctgaattgggttccgttattgaa
aaagaaatcatgggtattctggataacagattaaaggtaggctaa

DBGET integrated database retrieval system