KEGG   Thermoanaerobacter kivui: TKV_c01920Help
Entry
TKV_c01920        CDS       T03397                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase NagA
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00520  Amino sugar and nucleotide sugar metabolism
tki01100  Metabolic pathways
tki01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TKV_c01920 (nagA)
Enzymes [BR:tki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     TKV_c01920 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIS51397
UniProt: A0A097ANL7
Position
192578..193744
Genome map
AA seq 388 aa AA seqDB search
MENLLLKHGEIYTEDEIIYDGDLLISEGKIFDIGKNININDINVIDLKGKKVVPGFIDIH
IHGGVGHDTMEGTYEALNAISVHLARHGVTSFCATTMTMDIPYILDALRNIHETMKKGTE
GAQVLGAYVEGPFISKEHKGAQDERYILEPNIDIMDKFIEASNGNIKVIALAPEKDKNGE
FVEYVTKKNIRVSLGHTNATYEEMKNGVDHGATIAVHTYNGMKGLHHREPGALGEVFLDD
RLYSELICDFIHSHPAAVKILLKIKGTDRVVLISDAMAACGLGDGEYSLGGQKVYVKNGE
ARLENGTLAGSTLILDKAVANITSLGVPLFEACKMVSLNPAKAIGIDDRKGSIAIGKDAD
ITILNSDLTVDMTMVNGKIVHKKSDNNR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccttttattaaagcatggcgaaatatatacggaagatgagattatatatgac
ggagacttattaatttctgagggcaaaatttttgatataggtaaaaatataaatataaat
gatataaacgttatcgatttaaaaggaaaaaaggtggtgcctggatttattgatatacac
atacatggtggagtagggcatgacacaatggaaggtacttatgaagccttaaatgctatt
tcagttcaccttgcaaggcatggggttacatctttttgtgctactaccatgacaatggat
ataccctatattttagatgctcttagaaacatacatgagacaatgaaaaagggtacagaa
ggtgcgcaagttttaggtgcatatgtggaaggaccctttataagcaaagaacacaaaggg
gcacaggatgagaggtacatcttagaaccaaacatagacataatggacaagtttattgaa
gcttcaaatgggaatataaaagtaatagcactggcgccagagaaggacaagaatggggag
tttgtagaatatgtaactaaaaaaaatataagagtatcattagggcatacaaatgctact
tatgaagagatgaaaaatggagttgaccatggagcgacaatagcagttcatacatataat
ggcatgaaagggcttcaccacagggagccaggtgctttaggagaagtttttttggatgac
agattgtacagcgagttgatatgtgactttatacattcacatcctgcggcagtaaaaata
cttttaaagataaaagggacagatagagtagtattaatttctgatgctatggcagcttgt
ggtttaggagatggagaatacagtcttggagggcaaaaagtttacgtgaagaatggagag
gcaagacttgagaatggcactttggcaggaagtactttgatattggataaagctgtagca
aatataacgtctcttggagtaccactttttgaagcttgcaagatggtttctttaaatcct
gcaaaagcaattggcatagatgacagaaaaggcagtatagctataggaaaagatgctgat
ataaccattttaaacagtgatttgactgtagatatgacaatggttaatgggaaaattgtg
cataaaaaatcggataataaccgctga

DBGET integrated database retrieval system