KEGG   Thermoanaerobacter kivui: TKV_c03130Help
Entry
TKV_c03130        CDS       T03397                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00860  Porphyrin and chlorophyll metabolism
tki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tki00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TKV_c03130 (cobQ)
Enzymes [BR:tki01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     TKV_c03130 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO Peptidase_S51 GATase_5 GATase
Motif
Other DBs
NCBI-ProteinID: AIS51518
UniProt: A0A097ANZ1
Position
319942..321465
Genome map
AA seq 507 aa AA seqDB search
MALKLMIQGTASSVGKSLLVAAFCRIFKQDGYRVAPFKSQNMALNSYITDEGLEMGRAQV
MQAEAAGVKPSYHMNPILLKPSSDRMSQVILRGKVYKNMSATEYHKFKPELLKFIKEDFD
ILAKQSDIIVIEGAGSPAEINLRDRDIVNMGMAEMTNAPVLLVGDIDKGGVFASIAGTLL
LLNEDERRRIEGVIINKFRGDIEILKPGLRMLEDIVHKKVLGVVPYVDVHVDEEDGATDR
FYRTNAKGDVEIAVINLPHISNFTDFEPLAKIPGVKLRYVNKGERINDCDVVIIPGTKNT
IGDLQVLKQYKLDEEIFELRKKGKFIVGICGGYQMLGKSIKDPNQIESSLKEIEGLGLLN
IDTVIETEKTTTQVKAVVLDNLPQVLLSLRNIIVEGYEIHMGKSRIFEDSKPFSVITYRN
GEKIEVYDGCVSDDGKVFGTYIHGIFENREFVREFINIVRKSKGLSPVDEIIDYKEFKER
EYDRLADIVRKSIDMKEVYEIMERYRD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcacttaaattgatgatacaagggactgcatcttctgtgggcaaaagcttgttggtt
gccgctttttgcaggattttcaagcaggatggttacagagtagccccttttaagtcccaa
aacatggctttaaattcctatataaccgatgaaggtttggaaatgggaagagcgcaagtt
atgcaggcggaagcggcaggagttaagccttcttatcacatgaatccaatccttttaaag
cccagctctgatagaatgagtcaggtgattttaagaggcaaagtttataaaaacatgtct
gcaactgaataccacaagtttaagcctgaacttttaaagtttattaaagaggactttgat
attcttgcaaaacaaagtgacattattgtcatagaaggtgctggaagtcctgcggaaata
aatttaagggatagagatattgtaaacatgggtatggcagagatgacaaatgcgccagta
cttcttgtaggagatattgataaaggcggtgtatttgcctcaattgctggcactttactt
cttttaaatgaagatgagagaaggcgcattgaaggtgtaattataaacaagtttagagga
gacatagaaatattaaaaccgggtttaaggatgttagaagacattgtacacaaaaaagtt
ttaggtgttgttccttatgttgatgtgcacgttgatgaagaggatggtgcgacagacaga
ttctatcgcacaaatgctaaaggagatgtagagattgcggttataaatcttcctcacata
tcaaattttacagattttgaacctcttgctaaaattcctggagttaagctgcggtatgta
aataaaggggaaaggataaatgattgtgatgtagttataattccagggacaaaaaacaca
attggagatttgcaagtactaaaacaatataagcttgacgaggaaatttttgaattgcga
aaaaaggggaaatttatagttggcatttgtgggggctatcagatgttgggtaaaagcatt
aaagaccctaatcaaattgaaagttctcttaaagaaattgaagggctcggacttcttaac
attgatacagtaattgaaactgaaaagacgacgactcaggtgaaagcagttgttttagat
aatttgcctcaagtattgttatctcttagaaatattattgtagaaggatatgaaatacac
atgggcaaaagtcgcatttttgaggattctaaacctttttcagtgataacttatagaaat
ggagaaaaaattgaagtctatgacggttgtgtaagcgatgatggaaaagtgtttgggact
tatatacacgggatttttgaaaacagagagtttgtcagagaatttataaatattgtgaga
aaatcaaaaggactttctcctgtagatgaaattattgattacaaagagtttaaagaaaga
gaatatgataggcttgctgatattgtaagaaaaagtatcgacatgaaagaagtctatgaa
attatggaaaggtatagggattga

DBGET integrated database retrieval system