KEGG   Thermoanaerobacter kivui: TKV_c12580Help
Entry
TKV_c12580        CDS       T03397                                 

Gene name
pycB
Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00620  Pyruvate metabolism
tki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TKV_c12580 (pycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tki02000]
    TKV_c12580 (pycB)
Enzymes [BR:tki01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     TKV_c12580 (pycB)
Transporters [BR:tki02000]
 Other transporters
  Primary active transporters [TC:3]
   TKV_c12580 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AIS52429
UniProt: A0A097ARJ3
Position
1198624..1200021
Genome map
AA seq 465 aa AA seqDB search
MNSKVKITETVLRDAHQSLLATRMSTEEMLPIADKLDKVGYHSIEAWGGATFDACMRFLN
EDPWERLRRLKSKIKNTPLQMLLRGQNLLGYKHYPDDIVTKFIEKSIENGIDIIRIFDAL
NDVRNLEVAIKATKKAGAHAQGTLVYTISPVHNIDHYLKVAKELVQLGVDSICIKDMSGI
LTPYTAYELVKSLKETVNVPIQLHSHYTSGMAAMTYLKAIEAGADIIDTAISPLALGTSQ
PATETMVAVLKGTQYDTGLDMELLSEIAEHFKEVKQSHSKDSDLSMVTGVDTDVLIYQVP
GGMLSNLILQLKQQNALHKYEEVLKEIPRVREDLGYPPLVTPMSQMVGTQAALNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGNEEVIDVRPADLLKPQFEAIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAQKYKIDATLVNMEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaagttaaaattacggaaactgtattaagagatgcgcaccaatccctttta
gcgacaagaatgtcaacagaagaaatgcttcctattgcggataaattagataaagtagga
tatcattccatagaggcatggggaggagctacttttgacgcttgcatgagatttctcaat
gaagatccatgggagaggttgagaaggttaaagagcaaaataaaaaatacgccattgcag
atgcttttaagaggacaaaatttgttggggtataagcattatccagatgatatagtgaca
aaattcatcgagaagtctattgaaaatggcatagacataataagaatttttgatgcatta
aatgatgtacgaaatcttgaagttgctattaaagctacaaaaaaggcgggagcccatgct
caaggtacactggtttatactataagccctgttcacaacattgaccattaccttaaagta
gcaaaagagcttgtacaattaggtgttgattcaatatgcataaaagacatgtctggaatc
ctaactccttataccgcttatgaattagtgaaaagccttaaagaaacagtaaatgttcct
atacagttgcacagtcattataccagtggtatggcagctatgacctatttaaaggcaata
gaagctggggcggatataatagatactgctatatctcctttagcattggggacttctcag
cctgcaacagagactatggtagctgtattaaaaggtactcaatatgatacaggattggat
atggaactattatctgaaattgccgagcatttcaaagaagtaaaacaaagtcacagcaaa
gattctgatctgtctatggttacgggagtagatacagacgtactaatttaccaagttcca
ggtggaatgttgtcaaatttgattttacaattgaaacaacaaaatgcgttgcataaatat
gaagaagtattaaaagaaattcccagagtgagggaagatttaggctatccacctcttgtt
actcctatgagtcagatggtgggaacacaggcggctttaaatgtaataactggcgaaaga
tataaaatggttccaaaagaagtcaaagactatgtaaaggggttgtatggaaggccacct
gcccctatttctgaagaaataaaaaagaaaataataggaaatgaagaagtgatagatgtt
cggccagctgaccttttgaagccgcaatttgaagcgattaaagaagaaataaaagaatac
tacgaacaagaagaggatgttttatcttatgccctattccctcaggtagcaaaaaaattt
tttgaatacagacgagctcaaaaatacaaaatagatgcgactcttgtcaacatggaatat
atgacatatccggtttaa

DBGET integrated database retrieval system