KEGG   Thermoanaerobacter kivui: TKV_c12850Help
Entry
TKV_c12850        CDS       T03397                                 

Gene name
trpH
Definition
(GenBank) protein TrpH
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
tki  Thermoanaerobacter kivui
Brite
KEGG Orthology (KO) [BR:tki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TKV_c12850 (trpH)
Enzymes [BR:tki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     TKV_c12850 (trpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIS52456
UniProt: A0A097ARK0
Position
complement(1226415..1227248)
Genome map
AA seq 277 aa AA seqDB search
MFADLHMHSKASDGTNSPSVVVRLAKEHGLSCISLTDHDTVEGLEEAIEASFKYQIEVIP
GIEFNCYYKEQEVHILGYFINYRDQKFTEKLDEMKKLRNDRAMAIIKKLNELGIKITKED
VLEFTSEKFIGRPHIARAMIKKNYVESVKEAFDKYIGVGAPAYVERYRITPFKAIEYILE
NGAVPVLAHPGLLQEDAIIKELVNNGLVGIEVYHSKHTSHDVEKYLKKAKEYNLIITGGT
DFHGIEVDGRDLLGTIKLECEYVEILKSKAKNVEISK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagatttacatatgcattcaaaagcttctgacgggacaaattcaccttctgta
gtagttcgcttagcaaaagaacatggcctcagctgtatttcattgacagaccacgataca
gtagagggacttgaagaggctatagaggcttctttcaaatatcagattgaggttatccct
ggtattgaatttaattgttattataaagagcaagaggtgcatattttaggatactttata
aactacagggaccaaaaattcacagaaaagttggatgaaatgaagaaattgagaaacgac
agagctatggcaattataaaaaaactaaacgaattaggaattaaaattacaaaagaagat
gtgttagagtttacaagtgaaaagtttataggaagacctcatatagcaagagctatgatc
aaaaaaaattatgtagaaagtgttaaagaagcttttgacaaatacataggagttggagct
cccgcttatgttgaaaggtatagaataactccttttaaagcaatcgaatatattttagaa
aatggcgcagttcccgtcctagcccaccctggtttactgcaggaagacgccattattaaa
gagctggtaaacaacggattggttggtatagaagtttatcattctaagcacaccagtcat
gatgtagaaaaatatttgaaaaaagctaaggaatataatcttattataactggaggtacg
gactttcacggcatagaagttgatggcagagaccttttgggtaccatcaaacttgagtgt
gagtatgttgaaattttaaaaagtaaagcaaaaaatgtagaaatatcaaaataa

DBGET integrated database retrieval system