KEGG   Thioalkalivibrio sp. K90mix: TK90_0098Help
Entry
TK90_0098         CDS       T01174                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00020  Citrate cycle (TCA cycle)
tkm00310  Lysine degradation
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
tkm01200  Carbon metabolism
Module
tkm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tkm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TK90_0098
  Amino acid metabolism
   00310 Lysine degradation
    TK90_0098
Enzymes [BR:tkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TK90_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADC70615
UniProt: D3SC96
Position
107908..109221
Genome map
AA seq 437 aa AA seqDB search
MASDPTPIQVPELPESVADATVVALHKKAGDAVKRDELIAELETDKVVLEVSAPSAGTLT
ALEVSEGDVVKTDAVIGYLSAADEAAADDVDAEEEASTPAQDPRESTDTKAESSWSEKDD
RAQAAAKATPDRASGSAPPTPSPAVRRLLQEAGLKPEDVEGTGEDGRILREDVERAQAAR
SSAGQASSPAPKAERSPAREPAPTAGGIERVPMTRLRARIAERLLEAKQSTAMLTTFNEI
DMSAAMDLRARYKETFEKRHSIKLGFMGLFVAAASRALERFPIINAALDGEEIVYHHYSD
IGIAVSSPRGLVVPVLRDTGNASISEIERRIRDFAERARDGKLDIDELRGGTFTITNGGV
FGSLFSTPIVNPPQSAILGMHAIKERPVAVDGQVVIRPMMYVALSYDHRLVDGADAVRFL
VAIKDAIEDPARLLLDV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgatcccaccccgatccaggtccctgaactcccggagtctgtcgccgatgcg
accgtggtcgccctgcacaagaaggcgggcgacgcggtcaagcgcgatgaactgatcgcc
gagctcgagaccgacaaggtcgtgctcgaggtctctgctccgtccgccggcactttgacc
gcgctggaggttagcgagggcgatgtggtgaagacggatgcggtgattggctatctgagc
gcggccgacgaggccgccgcggatgatgtcgacgccgaagaagaggcctcgacgcccgct
caggacccccgcgagtccaccgacacgaaggcagagtcttcgtggtccgagaaggatgac
cgagcccaggccgccgcaaaggccacgcctgatcgtgcctcgggctctgcgccgcccact
cccagtccggccgtgcgccgcctgctgcaggaggccgggctgaagcccgaagatgtcgag
ggcacgggcgaggatggtcggattctgcgcgaggatgtcgagcgtgcgcaggccgcccgc
tcgagtgcgggtcaggcctcgtcacccgctcccaaagccgaacggtccccggcgcgagag
cccgcgccgacggcaggcggtatcgagcgtgtcccgatgacgcggctgcgcgcgcggatc
gccgagcggctgctggaggccaagcagtccaccgcgatgctgacgactttcaacgagatc
gacatgtccgccgcgatggacctgcgcgcgcgctacaaggagaccttcgagaagcgccac
tcgatcaagctgggcttcatgggcctgttcgtggccgccgccagccgcgcgctggagcgc
tttccgatcatcaatgccgcgctcgatggtgaggagatcgtctatcaccactacagcgat
atcggcatcgccgtctcctccccgcgcggcctggtggttccggtgctgcgcgacacgggc
aatgcatccatctcggagatcgaacggcgcatccgcgacttcgccgagcgcgctcgtgac
ggcaagctggacatcgacgagttgcgcggcggcaccttcacgatcaccaacggcggggtg
ttcggctcgctgttttccaccccgatcgtgaacccgccgcaaagcgccatcctcggcatg
cacgcgatcaaggagcgccccgtcgcggtggacggccaggtcgtgatccgcccgatgatg
tatgtcgccctctcctacgaccaccgtctggtcgacggtgccgatgccgtccgcttcctc
gtcgccatcaaggacgcgatcgaggatccggcgcgcctgctgcttgacgtctga

DBGET integrated database retrieval system