KEGG   Thioalkalivibrio sp. K90mix: TK90_0304Help
Entry
TK90_0304         CDS       T01174                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00540  Lipopolysaccharide biosynthesis
tkm01100  Metabolic pathways
Module
tkm_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    TK90_0304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tkm01005]
    TK90_0304
Enzymes [BR:tkm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     TK90_0304
Lipopolysaccharide biosynthesis proteins [BR:tkm01005]
 Unusual sugar
  TK90_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 KR Sacchrp_dh_NADP TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: ADC70819
UniProt: D3SD74
Position
324149..325102
Genome map
AA seq 317 aa AA seqDB search
MIIVTGGAGFIGSNLVKELNRRGRTDIVVVDNLTHGQKALNLTDCIIADYHDKEDFRDLI
EADAHLGPVEAVFHMGACSATTEWDGRYIMRNNFAYTRELFHWCQDRRIPFIYASSAAVY
GGNDTFREEPAHERPLNAYGYSKLAFDQYLRRHMDALTAQVVGLRYFNVYGPREGYKGGM
ASVIHHFSNQLREGDTVRLFEGCDGYADGEQRRDFVDVRDCVNLKLWLLEHPEVNGIYNC
GTGRARTFNDMARATIDWFGRGEIEYIPFPDHLKGRYQSYTQADLSQLRAAGCDLEFHDI
EDGVRAYLDAVAVDQAD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcgttaccggcggtgccggatttatcggcagcaacctggtcaaggaactcaat
cgtcgtggtcgcaccgacattgtcgtggtcgacaacctgacccacggccagaaggcgctg
aacctgaccgactgcatcatcgccgactatcatgacaaggaagacttccgcgacctgatc
gaggccgatgctcatctggggccggtggaggcggtattccacatgggcgcctgctcggca
accacggaatgggacgggcgctacatcatgcgtaacaacttcgcctacacccgtgagctg
ttccactggtgccaggatcgtcgcatcccgttcatttacgcctcttcggcggcggtgtat
ggcggcaacgacacctttcgcgaggagccggcccacgagcgtcctttgaacgcctacggc
tactccaagctcgcgttcgaccagtatctgcgccggcatatggatgcgctcaccgcgcag
gtcgtgggacttcgctacttcaacgtctacggcccgcgcgagggttacaagggcgggatg
gccagcgtgatccatcacttcagtaaccagctacgcgaaggggacacggtaaggctcttc
gagggctgtgacggctacgccgatggcgaacagcgccgcgacttcgtcgatgttcgcgat
tgcgtaaatctgaagctttggctgctggaacatcccgaggtgaatggcatctataactgc
gggaccgggcgcgcacggaccttcaacgacatggcccgggcgacgatcgactggttcggt
cgcggcgagatcgagtacatcccgttcccggaccacctgaagggccgttaccagagctat
acccaggcggatctgtcacagctgcgcgcggccggctgtgacctggaatttcacgatatc
gaggacggtgtgcgcgcctacctcgatgcggtcgcggttgatcaggccgactga

DBGET integrated database retrieval system