KEGG   Thioalkalivibrio sp. K90mix: TK90_0352Help
Entry
TK90_0352         CDS       T01174                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00010  Glycolysis / Gluconeogenesis
tkm00020  Citrate cycle (TCA cycle)
tkm00620  Pyruvate metabolism
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
tkm01200  Carbon metabolism
Module
tkm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0352
   00020 Citrate cycle (TCA cycle)
    TK90_0352
   00620 Pyruvate metabolism
    TK90_0352
Enzymes [BR:tkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TK90_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 PYNP_C GCV_H Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: ADC70867
UniProt: D3SDP7
Position
373411..374718
Genome map
AA seq 435 aa AA seqDB search
MSNTTTVHVPDIGDFKDVEIIEVIVSPGDTVSPEDPLITLESDKASIEIPAPQGGTVKTL
KVKAGDRVNEGDPILELEPSDEGAAEEASGKEEAPKEEAPAEPAPEAEEQKPSEAPKAAD
RADPRPSPTEHIRDESAFRKAHASPVVRKFARELGVDLAKVEGSGRKGRILREDVQGFVK
RALSQGAGGGLGVEPMPEIDFSEFGPVETQPLSKINKLTGKNLHRNWVTVPHVTQFDEAD
ITELEDFRKSLKAEYEKKGVKVTFLPFLMKAVVSALKQYPRFNASLDATGENLIIKQYYN
LGIAVDTPDGLVVPVVRDVDRKSLVDIASELMDLSQRARDKKLKPADMQGGCLTISSLGG
IGGTQFTPIVNAPEVAILGVSRSSMKPVWNGQEFEPRLILPLALSYDHRVIDGALGARFA
TTLSALLSDMRRMLL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacgactactgtgcacgtcccggatatcggcgacttcaaggacgtcgagatc
atcgaggtcatcgtcagcccgggggacaccgtttcccccgaggacccgctgatcacgctg
gaatccgacaaggcctccatcgagatccccgccccgcagggtggcacggtgaagacgctg
aaggtgaaggctggcgaccgcgttaacgagggcgacccgatcctggaactggagccctcc
gacgagggcgccgccgaggaggcctccggcaaggaggaagcgccgaaggaggaagcgccg
gccgaaccggcccccgaggccgaggagcagaaaccgtccgaggcgccgaaagccgccgac
cgggccgacccgcggccgtcgcccaccgagcacatccgtgacgagtcggccttccgcaag
gcgcatgcctcgccggtggtgcgcaagttcgcgcgcgagctgggcgtggacctggccaag
gtcgagggttccggacgcaaggggcgcatcctgcgcgaggacgtgcagggcttcgtcaag
cgtgcgttgagccagggcgccggcggtggcctgggcgtggagccgatgccggagatcgac
ttctccgagttcggcccggtcgagacccagccgttgtcgaagattaacaagctcaccggc
aagaacctgcaccgcaactgggtcactgtcccgcacgtgacgcagttcgacgaggctgac
atcaccgaactcgaggatttccgcaagtcgctgaaggccgagtacgagaagaagggcgtg
aaggtcaccttcctgccgttcctgatgaaggccgtggtctccgcgctcaagcagtatccg
cgcttcaacgcctcgctggatgccaccggcgagaacctgatcatcaagcagtactacaac
ctcggcatcgccgtggatacgccggacggtctggtcgtcccggtggtgcgcgacgtcgac
cgcaagagcctggtggacatcgcctccgagctgatggacctgtcccagcgcgcccgcgac
aagaagctcaagcccgcggacatgcagggcggctgcctgaccatctccagcctcggcggg
atcggtggcacccagttcaccccgatcgtgaacgcccccgaggtcgcgatcctcggcgtg
tcgcgctccagcatgaagccggtctggaatggccaggagttcgagccgcgcctgatcctg
ccgctggcgctgtcgtacgatcaccgggtgattgacggtgccctgggcgcccgcttcgcc
accacgctgagcgcattgctgtccgacatgcgccgcatgcttttgtaa

DBGET integrated database retrieval system