KEGG   Thioalkalivibrio sp. K90mix: TK90_1456Help
Entry
TK90_1456         CDS       T01174                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00860  Porphyrin and chlorophyll metabolism
tkm01100  Metabolic pathways
Module
tkm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TK90_1456
Enzymes [BR:tkm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     TK90_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ADC71960
UniProt: D3SAA5
Position
complement(1548808..1550295)
Genome map
AA seq 495 aa AA seqDB search
MNGTTLMVQGTTSDAGKSVLVAGLARVLHRRGLSVVPFKPQNMALNSAVTLDGGEIGRAQ
ALQAAACGLEPHTDMNPVLLKPTSDEGAQVIIHGRPAAELDARAYHDYKPVAREAVLASH
RRLTAQYAHVLVEGAGSPAEINLRAGDIANMGFAEAVDCPVILVADIDRGGVFAHLVGTL
ALLSETERARVQGFVINRFRGDISLLQPGLDWLEQETGKPVLGVIPYLHGLYLDAEDALP
REAVPQKVADALKVVVPALPRISNHTDFDPLRLHPAVDLRFAGPGESLQPADLIILPGSK
AVRDDLAWLREQGWEAELRRHVRYGGKVLGICGGFQMLGRVVHDPDGVEGRPGSTPGLGW
LDIETRLAPEKRLERVAGGRVLGQEAHVEGYEIHAGVTTGPGLDRALLELQHGPDGARSE
DDAVAGTYIHGVFDTSAAAEALLHWAGMRTGTEHGEDLATARERGLERLADTLEAHLDLG
RILALLRAGNSEAVT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtacaacgctcatggtgcaggggaccacctcggatgccggcaagagcgtgctg
gtggccgggctggcgcgggtgctgcatcgccgcgggctgtcggtggtgccgttcaagccg
cagaacatggcgctgaacagcgcggtcaccctggacggcggcgagatcgggcgcgcccag
gccctgcaggccgccgcctgcggcctggagccgcacaccgacatgaatccggtgctgctc
aagcccacctccgatgagggggcgcaggtgatcatccacggccgcccggcggccgagctg
gatgcccgcgcctaccacgactacaagccggttgcccgcgaggccgtgctggcctcgcat
cggcgactgaccgcgcagtatgcgcatgtgctggtggaaggcgcgggctcgccggcggag
atcaacctgcgcgcaggcgatatcgccaacatggggtttgccgaggcggtggactgtccg
gtgattctggtcgcggatattgaccgcggcggcgtgttcgcgcatctggtaggcacgctc
gcgctgttgagcgagacggagcgcgcgcgggtgcagggtttcgtgatcaaccgctttcgc
ggcgatatcagcctgctgcagccggggctggactggctggagcaggagaccggcaagccg
gtgcttggggtgatcccgtacctgcacgggttgtacctggatgccgaggacgccctgccg
cgcgaggcggtcccgcagaaggtggcggatgccctgaaggtcgtcgtgccggccctgccg
cgtatctccaaccataccgatttcgacccgctgcgcctgcacccggctgtggaccttcgc
ttcgccggcccgggcgagtcgctgcagccggcggatctgatcatccttcccgggtccaag
gccgtgcgtgatgacctcgcctggttgcgcgaacagggctgggaggccgagctgcgccgc
catgtgcgttatggcggcaaggtgctcgggatctgtggcggcttccagatgctgggtcgg
gtcgtacacgatcctgacggcgtcgaggggcggcctggttccacgccggggttgggctgg
ctggacatcgagacgcgcctcgcgcccgaaaagcgcctggagcgtgttgccggggggcgt
gtgctgggccaggaagcccacgtggagggctacgaaatccatgccggtgtgacgaccgga
cccggactggatcgcgccctactggagctgcagcatggcccggacggcgcgcgcagcgag
gacgatgcggtggcggggacctatatccatggggtattcgatacctccgctgccgccgag
gctttgctgcactgggccggcatgcgcacggggacggagcatggggaagacctggcgacc
gcccgcgagcgtggcctggaacgcctggccgataccctggaggcgcacctggacctgggg
cgcatcctcgcgctgctgcgggcaggaaactcggaggctgtgacatga

DBGET integrated database retrieval system