KEGG   Thioalkalivibrio sp. K90mix: TK90_1787Help
Entry
TK90_1787         CDS       T01174                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00450  Selenocompound metabolism
tkm00970  Aminoacyl-tRNA biosynthesis
tkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TK90_1787
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TK90_1787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tkm01007]
    TK90_1787
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tkm03016]
    TK90_1787
Enzymes [BR:tkm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TK90_1787
Amino acid related enzymes [BR:tkm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TK90_1787
Transfer RNA biogenesis [BR:tkm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TK90_1787
 Prokaryotic type
   Other AARSs
    TK90_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADC72278
UniProt: D3SB73
Position
1904476..1906512
Genome map
AA seq 678 aa AA seqDB search
MTDTPRKILVTSALPYANGPIHLGHLVEYIQTDIWVRFQRARGHEVIYVCADDAHGTPIM
LKARAEGIEPEELIARVRQEHEADFSEFLVDFDHYHSTHSDENRELAAHIYTALRDAGHI
ETRTIDQAYDPEAGMFLPDRFIKGTCPNCGAEEQYGDSCEACGATYSPLDLKDPVSAISG
ARPESRQSEHYFFKLGDFEAFLREWTGSGRLQDAIRNKLDEWFDAGLTDWDISRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMASFRAYAEKQGLDFDAWWGADSDAELYHFIGKDIAYFH
TLFWPAMLHGAGFRTPSAVFCHGFLTVNGQKMSKSRGTFIRARDYLDHLNPESLRYYLAA
KLGAGVDDLDLNLDDFVQRVNSDLVGKLVNIASRCAGFITKRSHGELAAELPRPDLHEAF
VAEGEAIAQAFEKREYAQAIRRIMALADQANQYIDEAQPWVLAKQEGREAEVQAISTQGL
DLFRILIVYLAPVLPKLAADAAAFLRLDSLAWDTRAPLVGHSIEKFKPLMTRIEGETVEK
LLEASKATLAATESTTTPDNKAEANVDPIADTIDFDTFAQVDLRIARIANAEHVEGADKL
LKLTLDIGSGTRQVFAGIKSAYAPEDLVGRHTVMVANLAPRKMRFGVSEGMVLAAGPGGS
DLYILHPDDGAQPGMRVK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacgccgcgcaagatcctggtcaccagcgccctgccctatgccaacgggccg
atccatctgggacacctggtcgagtacatccagaccgacatctgggtgcgctttcagcgt
gcacgcggccacgaggtgatctatgtctgcgcggatgacgcccacggcacgccgatcatg
ctgaaggcccgcgccgagggcatcgagcccgaggagctgatcgcgcgggtgcgtcaggaa
cacgaggccgacttcagcgagttcctggtcgatttcgaccactaccactcgacccactcg
gacgagaaccgcgagctcgccgcccacatctacaccgcgctgcgcgatgctggacacatc
gagacgcgcacgatcgaccaggcctatgatcccgaggccgggatgttcctgcccgaccgt
ttcatcaagggcacctgcccgaactgcggcgccgaagagcagtacggcgactcctgcgag
gcctgcggcgcaacctacagcccgctggacctgaaagacccggtctccgcgatcagcggc
gcccgtcccgagtcccgccagtccgagcactacttcttcaagctcggcgacttcgaggcc
ttcctgcgcgaatggaccggctccggccgcctgcaggacgcgatccgcaacaagctggac
gagtggttcgacgcgggcctgaccgactgggacatctcgcgcgacgccccctatttcggc
ttcgagatccccgacgccccgggcaagtacttctatgtctggctggacgccccgatcggc
tacatggcgagctttcgcgcctacgccgaaaagcagggcctggacttcgacgcctggtgg
ggcgcggactcggacgccgagctgtatcactttatcggcaaggacatcgcctacttccac
accctgttctggccggcgatgctccatggcgcgggtttccgcaccccgtcggcggtgttc
tgccacggcttcctgaccgtcaacggccagaagatgtccaagtcgcgcgggacctttatc
cgcgcccgcgactacctggaccacctgaaccccgagtccctgcgctactacctggcggcc
aagctgggcgccggggtcgatgatctcgacctcaacctcgacgacttcgtccagcgcgtg
aactccgatctggtcggcaagctggtcaacatcgccagccgctgtgccggcttcatcacc
aagcgttcgcacggcgaactcgcggccgaactgccgcgcccggacctgcacgaggccttc
gtagccgagggcgaggccatcgcccaagccttcgagaagcgcgaatacgcccaggccatc
cgccgcatcatggcgctggccgaccaggccaaccagtacatcgacgaggcccagccctgg
gtgctggcgaagcaggaaggccgcgaggccgaggtgcaggccatctccacccagggactg
gacctgttccgcatcctgatcgtctacctcgccccggtcctgccgaagctggcggccgac
gccgcggccttcctgcgcctggacagcctggcctgggatacgcgcgcgccactggtcggc
cactcgatcgagaagttcaagccgctgatgacgcgcatcgagggcgagaccgtggagaag
ctgctggaggcctcgaaggcgaccctggccgctaccgaatcgaccaccaccccagacaac
aaagcggaagccaacgtggaccccatcgccgacaccatcgacttcgacacctttgcccag
gtcgacctgcgcatcgcgcgcatcgccaacgccgagcacgtggaaggcgcggacaagctg
ctcaagctgacgctggatatcggttccgggacgcgccaggtgtttgccggcatcaagtcg
gcctacgcaccggaggacctggtcggccggcacaccgtaatggtggccaatctcgcgccg
cgcaagatgcgctttggcgtatccgagggcatggtcctggccgctggtcccggcggctcg
gatttgtacatcctgcacccggacgacggcgcccagcccggcatgcgggtaaaatag

DBGET integrated database retrieval system