KEGG   Thioalkalivibrio sp. K90mix: TK90_2259Help
Entry
TK90_2259         CDS       T01174                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00770  Pantothenate and CoA biosynthesis
tkm01100  Metabolic pathways
Module
tkm_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TK90_2259
Enzymes [BR:tkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     TK90_2259
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     TK90_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ADC72749
UniProt: D3SDF0
Position
2378377..2379594
Genome map
AA seq 405 aa AA seqDB search
MTEHDSKPRILVGVSGGIAAYKACELVRELRRAGCEVRVVMTAGAQAFVTPLTFQALSGA
PVRTELLDAEAESGMDHIALARWAERIVVAPASANLIARFAQGLADDLLSTLLLATTAPV
ALAPAMNHRMWAHPATQANIATLVERGVTLIGPDSGDQACGEQGEGRLREPAAIARELLQ
PADVPLAGRHVLITAGPTFEPIDPVRFIGNRSSGRMGFALAAAAREAGARVTLVHGPTAE
AVPAGIKGVATETAAAMHAAVMERLPETDILIAAAAVADYRPAEAQTQKIKKAAPVLNLT
LERTEDILAEAASHAATLPRRPFLVGFAAETEQLREHAEAKRRTKAVDLIAANRVGEGLA
FGTADNELLCIWEGGERTLPNQPKTQLARALIDLVIERLAERETD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacgattccaagccacggatactggtcggcgtcagcggcggcatcgccgcc
tacaaggcctgcgagctggtgcgcgaactgaggcgcgccggctgcgaggtgcgtgtggtg
atgaccgcgggcgcccaggccttcgtaaccccgctgactttccaggccctttccggcgcg
ccggtgcgcaccgagctgctggatgccgaggccgaatccggcatggaccacatcgcgctg
gcgcgctgggccgagcgcatcgtggtcgccccggccagcgccaacctgatcgcacgtttt
gcccagggcctggcggacgatctgctgagcaccctgttgctggccaccaccgcaccggtc
gcgctggcgccggcgatgaaccaccgcatgtgggcccatccggccacacaggccaatatc
gcgaccctggtcgagcgcggcgtaaccctgatcgggccggacagtggcgaccaggcctgc
ggcgaacagggcgagggccgcctgcgcgagccggccgcgatcgcgcgcgaactgctgcag
ccggccgacgtccccctggcgggacggcacgtgttgatcaccgccggccccacctttgaa
ccgatcgaccccgtccgcttcatcggcaaccgcagttccgggcgcatgggcttcgccctg
gccgcggccgcgcgcgaggccggcgcccgcgtgacgctggtacacggccccacggccgag
gccgtgcccgccgggatcaagggcgtggccaccgagaccgccgccgcgatgcacgcggcg
gtaatggaacgtctgcccgaaaccgacatcctgatcgccgcggcggcggtggccgactac
cgcccggccgaagcgcagacgcagaagatcaagaaggccgctccggtactgaacctcacg
ctggagcgcaccgaggatatcctggccgaggccgcaagccacgcggccacgctcccccgg
cgcccgttcctggtgggcttcgcagccgaaaccgagcaactgcgcgaacacgccgaggcc
aagcgtcgcaccaaggctgtcgacctgatcgcggccaatcgcgtgggcgagggcctcgcc
ttcggcaccgccgacaacgaactgctgtgcatttgggaaggcggtgaacgcaccctgccg
aaccagcccaagacgcagctggcccgggcactgatcgacctagtcatcgaacgtctggcc
gaacgtgaaaccgactga

DBGET integrated database retrieval system