KEGG   Thermococcus kodakarensis: TK0289
Entry
TK0289            CDS       T00226                                 

Name
(GenBank) pyruvate-formate lyase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00330  Arginine and proline metabolism
tko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TK0289
Enzymes [BR:tko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     TK0289
SSDB
Motif
Pfam: PFL-like Gly_radical TelA
Other DBs
NCBI-ProteinID: BAD84478
UniProt: Q5JFY6
Position
240573..243032
AA seq 819 aa
MSEAIETCCTNSHGKIEKELERRRSSIRPINERVAKLREESVNTEVRISSERARLITEFY
KSDLAKGKSIPVQRALAFKYLLEHCSLPVEDGQLIVGIRGTGVKEVPTYPEITVHSIEDL
EILNSRENMPYRVDEETKELYEREIIPFWKGRAMRDIIFENLPQEWIDAYEAGVWTEFME
QRAPGHTAGGERIFKMGVLDIKEEIRRKMEELDPSDPEYYEKMEELKAMDIVADAILIYA
RRYAEKLEKMAEEETDPKRKEELKQMAEICRWVPAHPPRTFWEALQHYWFIHVGVTYETN
PWDSFNPGRIDQHLYPFYKKDIEEGRLTREKAKELLQCFWLKFNNQPAVPKVGVTAEESF
TYNDFSKLNVGGLKEDGSDGVNELSYLILEVLGEMRTLQPNTAVLVSEKNPDCLLIEALK
VVGPGFGEPPFFNFDGVIVKMLRQGKSLEDARTSGVSGCVESGAFGKEAYILTGYFNLPK
ILEITLNNGVDPRTGKKIGLETGDPRDFKSFEELWEAFMKQVKHFLDIKMKGNDIIEALY
AKYLPVPFLSLWIEDCVEKAKDYNCGGARYNTQYIQVVGLGTIADSLAAIKYHVFDKKTF
TMDALLKALKNNWKGYEIMREILRNPDKTPKFGNDDDYVDEIAKRVVDEVVDLIESYPPS
PVRKASKRAYFLPTTVHVYFGKVTGATPDGREAGFPVSEGVSPVQGMDRKGIAAVFRSVA
KCDWDKTGGALLNQKLTPDIFDSEENIKKLAQLIRTFFRLGGHHVQFNVVSAELLREAQR
KPQDFQDLMVRVAGYSDYFVNLPEGLQEEIVQRTEQELL
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgagtgaggctattgagacatgttgtacaaacagccatggcaaaatagagaaggagctc
gagaggaggcgctcctccataaggcccataaacgagagggtcgctaaactcagagaagaa
agcgtgaacactgaggtgagaatctcttctgagagggcgaggctgataaccgagttctac
aagagcgacctggcgaagggaaaatcgatcccagttcagagggcgcttgccttcaagtac
ctcctcgagcactgtagcctacctgttgaagacgggcagctcatcgtcgggattaggggc
actggcgttaaagaggttccaacttatcctgaaatcaccgttcacagcatagaggacctt
gaaattttgaactcaagggagaacatgccatacagggttgatgaggagactaaagaactc
tacgagagggagataatccccttctggaaaggaagggcgatgagggatataattttcgag
aacctgccccaggagtggattgatgcttacgaagccggcgtctggacggagttcatggag
cagagggctccgggacacactgcgggtggcgagagaattttcaagatgggcgttctcgac
atcaaagaggagatcaggaggaagatggaggaactcgacccgagcgaccctgagtattac
gagaagatggaagagcttaaggcaatggacatcgttgcagatgcgattttaatctacgcc
cggagatacgctgaaaagctggagaaaatggcggaggaggagaccgaccccaagagaaaa
gaagagctgaagcagatggccgagatatgcaggtgggtgcccgctcatccccccagaacc
ttctgggaggccttacagcactactggttcatacacgtgggagtcacctatgagaccaac
ccgtgggactcattcaaccccggcaggatagaccagcacctctaccccttctacaagaag
gacatagaggagggaaggcttacgagggagaaagcgaaagagctcctccagtgcttctgg
ctcaagttcaacaaccagcctgccgttccgaaggttggggtgactgcggaggagagcttc
acatacaacgacttctcaaagctcaacgttggcggactgaaggaggacggctccgatgga
gttaatgagctctcctatctgattcttgaagtcctcggcgagatgaggactttgcagcca
aacactgccgtgctggtgagcgagaagaaccctgactgcctcctcattgaagccctgaag
gtggttgggccgggattcggcgagccgccgttcttcaacttcgacggcgtcatagtgaag
atgctcaggcagggtaagagccttgaggatgcgagaacttcgggagtgagcggctgcgtg
gagagcggagccttcgggaaggaagcctacatactcaccggctacttcaacctgccaaaa
atcctcgagataaccctcaacaacggcgttgatccaagaactggcaagaagattggcctt
gaaaccggcgacccgagggacttcaagagctttgaggagctctgggaggccttcatgaag
caggtcaagcacttcctcgacataaagatgaagggcaacgacataatagaggccctctat
gccaagtaccttccggtcccgttcctatctctgtggatagaggactgcgttgagaaggct
aaggactacaactgtgggggagcgaggtacaacacccagtacatccaggttgttggtctg
ggaactatcgcggacagcctcgctgcaataaagtaccacgtatttgacaagaagactttc
acaatggacgcgcttctcaaggcgctgaagaacaactggaagggctatgagattatgagg
gaaatactccgcaaccccgataaaactcccaagtttggaaacgacgatgactacgtcgac
gagatagccaagagagtcgtggatgaggttgttgacctcatcgagagctatccaccttct
ccggttaggaaagcatcaaagagggcttacttcctcccgacgactgttcacgtttacttt
gggaaggtcacgggagcaacgcccgatggcagggaggcggggttcccggtttcagaggga
gtctcaccggtccaggggatggacaggaagggtatagctgcagtgttcaggagcgttgcc
aagtgcgactgggacaagacagggggagcgttgctcaaccagaagctgacgcccgacatc
tttgacagtgaggagaacatcaagaagctggcgcagctgataaggacgttctttaggctt
ggtggccaccatgtgcagttcaacgttgtgagtgctgagctcctcagggaggcccagagg
aagcctcaggacttccaggatttgatggtgagggtggcgggctacagtgattacttcgtc
aaccttccggaggggctgcaggaggagatagttcagagaaccgagcaggagctcctttga

DBGET integrated database retrieval system