KEGG   Thermococcus kodakarensis: TK0551Help
Entry
TK0551            CDS       T00226                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00260  Glycine, serine and threonine metabolism
tko00680  Methane metabolism
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01200  Carbon metabolism
tko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    TK0551
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK0551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tko04147]
    TK0551
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     TK0551
    1.1.1.399  2-oxoglutarate reductase
     TK0551
Exosome [BR:tko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN Shikimate_DH NAD_Gly3P_dh_N AdoHcyase_NAD ApbA Rossmann-like ThiF DpaA_N
Motif
Other DBs
NCBI-ProteinID: BAD84740
UniProt: Q5JF48
Position
474246..475247
Genome map
AA seq 333 aa AA seqDB search
MRPRVLVTFKMKSKPVEELKKYADVDFLLYPSVEELAEKIKDYDGLIVSPLNRVPREVIE
RAERLKVISCHSAGYDHVDVEAATKKGIYVTKVSGVLSEAVAEFAVGLTIALLRKFVYTD
KLIRRGEWDSHAKIWSTFKDIETVYGKKVGILGMGAIGKAIARRMKAMGTEILYWSRSRK
EDIEAEVGAKYLPLDEVLRESDIVILALPATPETYHIINEERIKLLEGKYLVNIGRGTLV
DEKAVVKAIEEGRLKGYATDVFEKEPVTEHPLFKYEWETVLTPHHAGLSKEAMEDMGFQA
VMNLLAVLRGEIPKDLVNREVVKVRPPEEVKML
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgagagttcttgtgacatttaagatgaagagcaagcccgtcgaggagctgaag
aagtacgccgacgttgattttctgctatatcccagcgttgaagagctggctgagaagatc
aaggactacgacgggcttattgtctccccgctgaacagggttccgcgggaagtaattgaa
cgggccgagaggctcaaggtcataagctgtcattcagccggctatgaccatgttgatgtg
gaagccgcgaccaagaaggggatctacgtcaccaaagtttcaggggttctgagcgaggct
gtggcagagttcgccgttggcctgacgatagcccttctcaggaagttcgtttacaccgac
aagctcatcaggaggggtgaatgggacagccacgccaagatatggagcaccttcaaggac
attgaaaccgtctatggcaagaaggttggaatcctcggcatgggggccatcggaaaggcc
atagcgaggagaatgaaggccatgggaacggagatactctactggtcgcgctcgagaaaa
gaagacatcgaagctgaggtcggggcgaagtacctcccgctcgacgaagtcctgagggag
agcgacatcgtcatcttagcccttcccgcaactccagaaacctaccatatcatcaacgag
gaaagaattaagctccttgagggcaagtacctcgtcaacataggcaggggaaccctcgtg
gacgagaaggccgtcgttaaggccattgaagagggcaggctgaagggctacgcgacggat
gtctttgagaaggagcctgtaactgagcacccgctcttcaagtacgagtgggagactgta
ttaacaccacaccacgcgggcctttcgaaggaagctatggaagacatgggctttcaggcg
gtaatgaacctcctcgccgtccttagaggagaaataccaaaagacctcgtgaacagggaa
gtcgtgaaggttcgcccgccggaagaagttaagatgctgtga

DBGET integrated database retrieval system