KEGG   Thermococcus kodakarensis: TK0673Help
Entry
TK0673            CDS       T00226                                 

Definition
(GenBank) short-chain alcohol dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00030  Pentose phosphate pathway
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TK0673
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     TK0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short NAD_binding_10 KR NmrA
Motif
Other DBs
NCBI-ProteinID: BAD84862
UniProt: Q5JF02
Position
577793..578572
Genome map
AA seq 259 aa AA seqDB search
MRVIVTASSRGIGFNVARELLKRNARVVISSRNSEHLKMAEKELAEFGEVQTVKANLYDQ
RELENLVKTSWELLDGIDALIWNAGNVRCEPCFLHEATYMDWLEAAALHSVAPGYLTTLL
VQTWLEKKMKGTLVYLNSVSVKEPMPPLVLADVTRAGLIQLAKSVSRTYGKYGIRAYSVL
LGSFDTPGARENLRKLAEERGEPFEETWEREVLSRTPLHRTGRWEELGSLVAFLLSEEAE
YMLGSTVVIDGAMTRAVDI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcatcgtcactgcatcatcaaggggtatcggcttcaacgtcgcgcgcgaactc
ctgaagagaaacgcaagggtcgtcatcagctccaggaattccgaacatctcaagatggcc
gaaaaagagctggcggagttcggagaagtccaaactgttaaggcaaacctatacgaccag
cgggagctggagaaccttgtaaaaacttcctgggaacttctcgacggaattgatgcccta
atctggaatgccggcaacgtgaggtgcgagccctgcttcctccacgaggccacctatatg
gactggcttgaggcggccgcactccattccgtcgcgccaggctacctcacgacgctccta
gtccagacctggctggaaaagaagatgaagggaacgctcgtttatcttaactcggtctcg
gtgaaggagccaatgcctccgctggttctggcggacgtgacgagagctggactaatccag
ctggcgaagagcgtttcgagaacctacgggaagtacggcatcagggcctactcggtgctt
ttgggaagcttcgacacccccggtgcgagggaaaacctgagaaaactggccgaggaaagg
ggagaaccctttgaggagacctgggagagggaagtcctctcgaggacaccgctccacaga
acgggcaggtgggaagagctcggctcgctggtggccttcctgctgagcgaggaagctgag
tacatgctcggctctacggtcgttatagacggggcgatgacgagggcggtggacatttga

DBGET integrated database retrieval system