KEGG   Thermococcus kodakarensis: TK0683Help
Entry
TK0683            CDS       T00226                                 

Definition
(GenBank) glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00630  Glyoxylate and dicarboxylate metabolism
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
tko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TK0683
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     TK0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN AdoHcyase_NAD PDH NAD_binding_7 AlaDh_PNT_C Rossmann-like Shikimate_DH Gp_dh_N XdhC_C GFO_IDH_MocA Sacchrp_dh_NADP DUF3098
Motif
Other DBs
NCBI-ProteinID: BAD84872
UniProt: Q5JEZ2
Position
complement(590036..591037)
Genome map
AA seq 333 aa AA seqDB search
MRPKVFITRAIPENGIEMLKEHFEVEVWPEEREIPREVLLKKVRDVDALVTMLSERIDSE
VFDAAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLI
EADHFTRSGEWKRRGIAWHPRWFLGYDVYGKTIGIVGFGRIGQAVARRARGFGMRILYYS
RSRKPEAEKELGAEFRSLEDLLRESDFVVLAVPLTKETQYMINEERLRLMKKTAILVNIA
RGKVVDTKALMKALKEGWIAGAGLDVYEEEPYYNEELFSLKNVVLAPHIGSATYGAREGM
AELVARNLIAFKNGEVPPTLVNKEVVKVRKPGF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctaaggttttcataacccgtgccattcccgagaacggcatcgagatgctgaag
gagcactttgaggttgaggtatggcccgaagagcgcgagatacccagggaggttctactc
aagaaggtcagggacgtcgatgctctagtaacaatgctgagcgagaggattgacagtgag
gtcttcgacgccgctccgaggctgaggatagtggcaaattacgcagtcggctacgacaac
atagacgtcgaagaggccacgaggaggggcatctacgtcaccaacacgcccgacgtcctg
accgacgccactgctgactttgcctggacgctccttctagcaacggccaggaggctgata
gaggccgaccacttcacccgctccggagagtggaagaggagaggaatcgcctggcatccg
cgctggttcctcggctacgacgtttacgggaagacgatcggaatagtcggcttcggaagg
ataggacaggcagttgccaggcgcgcaagggggtttggcatgagaatcctatactactcc
aggagcaggaagccagaggctgaaaaggagcttggggctgaattcaggtcgcttgaggac
ctgttgagggagagcgacttcgttgtcctggcggtgccgctgactaaggaaacccagtac
atgataaacgaggaaaggctgaggctcatgaagaagactgccatactggtgaacatagca
cgaggcaaggtcgtggatacaaaagccctcatgaaggccctgaaagagggctggattgca
ggggccggtctcgacgtctacgaggaagagccgtactacaacgaggagctgttcagcctg
aagaacgtcgttctagcgccgcacatagggagcgcgacctacggggcgagggagggcatg
gcagagctggtcgcgaggaacctcatagcgttcaagaacggtgaagtacctccgaccctc
gtgaataaggaagtcgtgaaggttagaaaacccggcttctga

DBGET integrated database retrieval system