KEGG   Thermococcus kodakarensis: TK1066Help
Entry
TK1066            CDS       T00226                                 

Definition
(GenBank) tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00030  Pentose phosphate pathway
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TK1066
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TK1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAD85255
UniProt: Q5JE15
Position
complement(936932..938749)
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFLRVNLSTGEVKVEEYGEELAKKWLGSRGLAIYLLLKEMDPKADPLGPENKLI
ITPGPLTGTSAPTGGRYNVVTKSPQTGFITMANSGGYFGAELKFAGWDAIVVEGQSEKPV
YIYIKDDHVEIRDASHLWGKVVSETEAAIKKEIGSNKLHIASIGPAGENLVKFAAIMNDG
HRAAGRAGVGAVMGSKKLKAIAVEGSKRVPIADKQKFMLVVREKINKLRNDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMTAKYLIRNQPCYACPIGCGRVNK
LPTLGVTEGPEYESIWALGANLGINDLASIIEANHQCDEFGLDTISTGGTLAAAMELYEK
GYLTDDELGDAPPFRWGNTEVLHYYIEKIAYRKDLGDKLAEGSYRFAEMYGHPEFSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDEKVKMLIL
FQDLSALIDAAGLCLFTTFGLGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERLFNLK
AGLDPAKDETLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYKLRGWTEDGRIPREKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaactggggaagatttctgcgcgtgaacctctccacaggagaggtcaaagtt
gaggagtacggtgaagagcttgccaagaagtggctcgggagcaggggtctggccatctac
ctcctcctgaaggagatggacccgaaggcagacccgcttgggccagagaacaagctgatt
ataacccctggcccgctaactggtacgagcgcccccactgggggcagatacaacgtcgtt
acgaagagcccgcagacgggcttcataaccatggcgaactctggcggatacttcggtgcg
gagcttaagttcgctggctgggatgctatcgtcgttgagggccagtccgagaagcccgtt
tacatttacatcaaggatgaccacgttgagatacgcgatgcctcccacctctggggcaag
gtggtgagcgagactgaggctgcgataaagaaggagattggaagcaacaagctccacata
gcgagtatcggcccggccggtgagaacctcgttaagttcgcagctattatgaacgacggc
caccgcgccgctggtagggctggcgttggagccgttatgggaagcaagaagctcaaggcc
attgccgttgagggaagcaagcgcgttccaatagcggacaagcagaagttcatgctggtt
gtgagggagaaaatcaacaagcttaggaatgaccccgttgctggaggcggacttccgaag
tacggtacggctgttctggtcaacataatcaacgagaacggcctctatccaactagaaac
ttccagaccggtgtctttgagcacgcctatgagcagagcggtgaggcgatgactgccaag
tacctcataaggaaccagccgtgctacgcctgtccgatcggttgtggcagggttaacaag
ctcccgaccctcggcgtgacggaagggccagagtacgagagcatctgggcgctcggtgcc
aacctcggcataaacgacctcgcgagcatcatagaggccaaccaccagtgcgacgagttc
ggtcttgacactatctcgactggtggaacgcttgcagcggctatggagctctacgagaag
ggctacctcacggacgatgagcttggggacgctccgcccttcaggtggggcaacaccgag
gttcttcactactacatagagaagatagcctacaggaaggatctcggtgacaagctggca
gagggaagctaccgcttcgctgagatgtacggccacccggagttctcaatgagcgtcaag
aagcttgagcttcctgcctacgacccgcgtggagccgaaggacatggtctcggctatgcc
accaacaaccgcggcggctgccacatcaagaactacatgataagccccgagatcctcggc
tacccatacaagatggacccgcacgacataagcgacgagaaggtgaaaatgctcatcctc
ttccaggatctcagtgcgctcattgacgccgccggtctctgtctcttcacgaccttcggc
cttggagcggacgactaccgcgacatgctcaatgccgctctcggctgggacttctccact
gaggattacctcaagattggagagagaatatggaacgctgaaaggctattcaacctcaag
gcgggcctagaccctgctaaggacgagaccctgcctaagaggttccttgaggagccgatg
cccgaagggccgaacaagggccacgtcgtcaggcttaaggagatgctgccgcgctactac
aagctgcgcggctggacagaggacggaaggatcccaagggagaaagcggaagagctcggc
atcgccgagttcctctga

DBGET integrated database retrieval system