KEGG   Thermococcus kodakarensis: TK1108Help
Entry
TK1108            CDS       T00226                                 

Definition
(GenBank) phosphohexomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00010  Glycolysis / Gluconeogenesis
tko00030  Pentose phosphate pathway
tko00051  Fructose and mannose metabolism
tko00052  Galactose metabolism
tko00230  Purine metabolism
tko00500  Starch and sucrose metabolism
tko00520  Amino sugar and nucleotide sugar metabolism
tko00521  Streptomycin biosynthesis
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1108
   00030 Pentose phosphate pathway
    TK1108
   00051 Fructose and mannose metabolism
    TK1108
   00052 Galactose metabolism
    TK1108
   00500 Starch and sucrose metabolism
    TK1108
   00520 Amino sugar and nucleotide sugar metabolism
    TK1108
  Nucleotide metabolism
   00230 Purine metabolism
    TK1108
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TK1108
Enzymes [BR:tko01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TK1108
    5.4.2.8  phosphomannomutase
     TK1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAD85297
UniProt: Q68BJ6
Position
complement(971897..973267)
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGIANEEITPEFALKIGMAFGTLLKREGRERPLVVVGRDTRVSGEMLKDA
LISGLLSTGCDVIDVGIAPTPAIQWATNHFNADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAIVEELFFSEDFHRAKWNEIGELRKEDIIKPYIEAIKNRVDVEAIKKRRPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFGV
AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIAKRNGA
KVMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSGKKF
SELIDELPKYYQFKTKRHVEGDRKAIVAKVAELAEKKGYKIDTTDGTKIIFDDGWVLVRA
SGTEPIIRIFSEAKSEEKAREYLELGIKLLEEALKG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctctttggaacgtttggcgttagggggatagcgaacgaggagataacccca
gagttcgcccttaaaatcggcatggcctttggaacactcctcaagagggaaggtagagaa
aggccgctcgtcgttgtcggcagggatacgagggtgagcggtgaaatgctcaaggacgcc
ctcatcagcggacttttgagtaccggttgcgacgtcatagacgttgggatagctccaacc
cctgcaatccagtgggccaccaatcacttcaatgccgacggtggagcggtcataaccgcc
tcccacaacccgcccgagtacaacggcataaagctccttgaaccgaacggcatggggttg
aagaaggaaagggaagccatcgttgaggagctgttcttcagtgaggacttccacagggct
aaatggaacgagattggtgagctgaggaaggaggacataatcaagccctacatcgaggcg
ataaagaacagggtagatgtggaggcgataaagaagaggagacccttcgtcgtcgttgac
acctccaacggcgctggcagtctaaccctgccctatctattgagagagctcggctgtaag
gttgtttccgttaatgctcatccagacggccacttccctgccaggaatcccgaaccgaac
gaggagaacctcaagggtttcatggagatcgttaaagctcttggagctgacttcggcgtt
gctcaggatggagacgctgacagggcggttttcatcgacgagaacggccgcttcatccag
ggcgataagacgttcgcgctggtagccgacgcagtcctcagggaaaacggcggcgggctt
ttagttacgaccatagcgacttccaacctcctcgacgacatagcgaagaggaacggagcc
aaagttatgagaacaaaggtgggtgatttaatcgttgccagggctctcctcgaaaacaac
ggcaccataggcggcgaggagaacggcggcgttatcttcccggacttcgtgctcggcagg
gacggggcgatgacaacggcgaagatagttgaaatctttgccaagagcgggaaaaagttc
agcgagctgatagacgagctgccaaagtactaccagttcaagacgaagaggcacgttgag
ggtgacaggaaggctatagttgccaaagtggcagagcttgcagagaagaaaggctacaag
atagacaccaccgacgggactaagataatcttcgacgacggctgggttctcgtgagggca
agcggaaccgagccgataatcagaatcttcagcgaggccaagagcgaggaaaaggcaagg
gagtaccttgagcttgggattaagttgcttgaagaagcgcttaagggctga

DBGET integrated database retrieval system