KEGG   Thermococcus kodakarensis: TK1569Help
Entry
TK1569            CDS       T00226                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00010  Glycolysis / Gluconeogenesis
tko00071  Fatty acid degradation
tko00350  Tyrosine metabolism
tko00625  Chloroalkane and chloroalkene degradation
tko00626  Naphthalene degradation
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1569
  Lipid metabolism
   00071 Fatty acid degradation
    TK1569
  Amino acid metabolism
   00350 Tyrosine metabolism
    TK1569
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TK1569
   00626 Naphthalene degradation
    TK1569
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TK1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DUF1967 DUF2007
Motif
Other DBs
NCBI-ProteinID: BAD85758
UniProt: Q5JIP8
Position
complement(1378410..1379474)
Genome map
AA seq 354 aa AA seqDB search
MVTGRSSTKKTGLLYRVQELLKKAGVESIVFDRVIPNPISTHVDEAAELARRENVDFVVG
LGGGSAIDSAKAIAMTAKSGGKYWDYVPAVGGGKKPSGALPIVAIPTTHGTGTEADPYAV
ITNPETKEKQGIGYDVLFPKFSIVDPEVMVTLPQNQTVYTSMDAFYHSIEAFLNVRAQPY
SDVLALDSMRRVVTYLPIAYENLQDLEARTQLAWASTEAGITETLTGVIANHALEHGLSG
FYPEVPHGLGLCILGPYLFEYILDHAYERLAIVGREVFGVYESNDRKAAELAVKKLRDFQ
SLFGVNKKLRELGVKEEDIPKMAETAYRMMKGVIDVTPGNLSVEDLEEIYRRAY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggggaggagcagcactaagaaaactggcctcctctacagggttcaggagctt
ctcaagaaggcgggcgttgagagcatcgtcttcgacagagtcattccgaatccgatttca
acccacgtggatgaagccgctgagctcgcgaggagggagaatgtggacttcgtcgtgggg
ctcggcggcggaagcgcgatagacagcgccaaggcaatagccatgaccgccaagagcggg
ggcaagtactgggactacgttccggccgtcggcggaggaaaaaagccgagcggggcgctg
ccgatagtggcgatccccacaacccacgggactggcacagaggcagacccctacgcggtc
ataaccaaccctgaaacgaaggagaagcaggggatagggtacgatgtcctctttccgaag
ttttcaatagtcgaccctgaggtcatggtaaccctgccacagaaccagaccgtctacaca
tcgatggacgctttctaccactccatcgaagctttcctcaacgtcagggcccagccatac
tccgacgtcctggccctcgactcgatgagacgagttgttacctacctcccgatagcctac
gaaaacctccaagacctggaagcaagaacccagctcgcctgggcgagcaccgaggcgggg
ataaccgagaccctaacgggagttatagcgaaccacgctctcgaacacgggctcagcggg
ttctaccccgaagtgccccacgggttgggactgtgcatcctggggccatacctgttcgag
tacatcctcgatcacgcctacgagcgccttgcaatcgttggcagggaggttttcggggtc
tacgagagcaacgacagaaaggctgcagagctcgcggtcaagaagctccgcgacttccag
agtctctttggagtcaacaagaagctcagggagctcggcgtgaaggaggaggacattccg
aagatggcggaaacggcctacaggatgatgaagggtgttatagacgtcacgccggggaat
ctgagcgttgaggatcttgaggagatttacaggagggcatactga

DBGET integrated database retrieval system