KEGG   Thermococcus kodakarensis: TK1966Help
Entry
TK1966            CDS       T00226                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00260  Glycine, serine and threonine metabolism
tko00680  Methane metabolism
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01200  Carbon metabolism
tko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    TK1966
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK1966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tko04147]
    TK1966
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     TK1966
    1.1.1.399  2-oxoglutarate reductase
     TK1966
Exosome [BR:tko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AlaDh_PNT_C IlvN F420_oxidored XdhC_C AdoHcyase_NAD 3HCDH_N NmrA NAD_binding_7 NAD_binding_10 PrpR_N
Motif
Other DBs
NCBI-ProteinID: BAD86155
UniProt: Q5JGC4
Position
complement(1772935..1773849)
Genome map
AA seq 304 aa AA seqDB search
MKVLVAAPLHEKAIEVLKNAGFEVVYEEYPDEDRLVELVKDVDAIIVRSKPKVTRKVIEA
APKLKVIGRAGVGLDNIDLKAAEERGIKVVNSPGASSRSVAELAIGLIFAVARKIAFADR
KMREGVWAKKQCMGIELEGKTIGVVGFGRIGYQVAKIANALGMKVLFYDPYPNEERAKEV
GGKFADLETLLKESDVVTLHVPLVDATYHLINEERLKLMKPTAILINAARGAVVDTDALV
KALQEGWIAGAGLDVFEEEPLPADHPLTKLDNVVLTPHIGASTVEAQMRAGVEVAEKIVE
ALKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctcgttgccgctccgcttcacgagaaggcgatagaggttttgaagaacgcc
ggctttgaggtcgtttacgaggagtatcccgatgaggacaggctcgttgaactcgttaaa
gacgtcgatgcgataatcgttaggagcaagccgaaggtaaccaggaaggtcatcgaggcc
gctcccaagctcaaggtcataggaagggctggcgttggcctcgacaacattgacctcaag
gccgccgaggagaggggaattaaggtcgtaaacagtcctggggctagctccaggagcgtc
gccgaactggccatcggccttatcttcgccgtcgcgaggaagatagccttcgccgacagg
aagatgagggaaggcgtctgggccaagaagcagtgcatgggaatagagcttgagggcaag
accattggagtcgtcggcttcggaagaataggctaccaggttgcaaagatagcgaacgcc
ctcggcatgaaggttctcttctacgacccgtatccaaacgaggaaagggcaaaggaggtc
ggaggaaagtttgctgaccttgagacgctcctgaaggagagcgacgtcgttacgctccac
gtcccgctggttgatgcaacctaccacctcataaacgaggagaggctcaagctcatgaag
ccgaccgccatactcatcaacgccgcaaggggtgcggtagttgacaccgatgccctcgtc
aaggcccttcaggagggctggatcgcgggagcaggccttgatgtcttcgaggaggagccc
cttccagcagaccacccgctcacaaagcttgacaacgttgttctaacgccgcacatcggc
gcctcgactgttgaggcccagatgagggcaggcgtcgaggtcgccgagaagatagtggaa
gccctcaagggctga

DBGET integrated database retrieval system