KEGG   Thermococcus kodakarensis: TK1983Help
Entry
TK1983            CDS       T00226                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00010  Glycolysis / Gluconeogenesis
tko00020  Citrate cycle (TCA cycle)
tko00620  Pyruvate metabolism
tko00640  Propanoate metabolism
tko00650  Butanoate metabolism
tko00680  Methane metabolism
tko00720  Carbon fixation pathways in prokaryotes
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1983
   00020 Citrate cycle (TCA cycle)
    TK1983
   00620 Pyruvate metabolism
    TK1983
   00640 Propanoate metabolism
    TK1983
   00650 Butanoate metabolism
    TK1983
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TK1983
   00680 Methane metabolism
    TK1983
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TK1983
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TK1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C DUF4290
Motif
Other DBs
NCBI-ProteinID: BAD86172
UniProt: Q5JIJ7
Position
1786849..1788033
Genome map
AA seq 394 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRALSAPINIWND
WQDTISERDTGWLQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPERPITQGTLAFPAHYMEARYTVWEANENAKKVIDEVF
AEFEKKFGRKYQKVEEYRTEDAEIIFVTMGSLAGTLKEYVDHLREKGLKVGAAKLTVYRP
FPTEEVRELAKKAKVLALLEKNVTFSVGGALFQDFSRALVNLDERPKIVDFILGLGGRDV
TFKDLDEALAIAQKALNGEEFDEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgataagaaccgttatgaaggcaaacgaggctgccgcctgggcggccaagctggcc
aagcccaaggttatcgcggccttccccattaccccgtcaacgctcgttccagagaagatt
agtgaattcgtcgccaacggggagctcgacgccgagttcatcaaggtcgagagcgagcac
tcagctatctccgcctgtgttggtgccagcgccgctggggttagaacattcacagcaacc
gcttcccagggtctcgccctgatgcacgaaatactcttcatcgccgctggaatgcgcctt
ccgatagtcatcgccgttggaaaccgtgccctttcagccccgatcaacatctggaacgac
tggcaggacacgataagcgagcgcgatactggatggctccagttctacgccgagaacaac
caggaagctctggacctcatactcatagccttcaaggtagccgaggacgaaagggttctc
cttccggcaatggttggcttcgacgcgttcatcctgacccacacagttgagccagttgag
attcccgaccaggaggtcgtcgacgagttcctcggtgagtacgagccgaagcacgcctac
ctcgatccggagagaccgataacccagggcaccctcgccttcccggcccactacatggag
gccagatacaccgtctgggaggccaacgagaatgcaaagaaggtcatcgacgaggtcttc
gccgagttcgagaagaagttcggtagaaaataccagaaggtcgaggagtacaggactgag
gacgcagagataatcttcgtcaccatgggttcactcgccggaaccctcaaggagtacgtt
gaccacctcagggagaagggcctcaaggtcggcgctgcgaagctcaccgtttacaggccg
ttcccgaccgaagaagtcagggagctcgccaagaaggccaaggttctcgcgctccttgag
aagaacgtcaccttcagcgttggtggagcactcttccaggacttcagcagggccctcgtc
aaccttgacgagaggccgaagatcgtcgacttcatcctcggcctcggtggcagggacgtc
acattcaaggacctcgacgaggcactggccatagcccagaaggccctcaacggtgaggag
tttgatgaggtcaactggatcggcctgaggaaggagatactgtga

DBGET integrated database retrieval system