KEGG   Thermococcus kodakarensis: TK2129Help
Entry
TK2129            CDS       T00226                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00010  Glycolysis / Gluconeogenesis
tko00051  Fructose and mannose metabolism
tko00562  Inositol phosphate metabolism
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01200  Carbon metabolism
tko01230  Biosynthesis of amino acids
Module
tko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tko_M00002  Glycolysis, core module involving three-carbon compounds
tko_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK2129
   00051 Fructose and mannose metabolism
    TK2129
   00562 Inositol phosphate metabolism
    TK2129
Enzymes [BR:tko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TK2129
Exosome [BR:tko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TK2129
  Exosomal proteins of bladder cancer cells
   TK2129
  Exosomal proteins of melanoma cells
   TK2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh NMO DHO_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAD86318
UniProt: Q5JHG3
Position
1909411..1910091
Genome map
AA seq 226 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAERVWKETGITIVVAPQLADLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEVGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVVTNTVELVKKVNPDVGVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPENAIRDLVSLII
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctaaaggagccgattatagcgataaacttcaagacctacatcgaggcaaca
ggaaagagggctctggagatagcgaaggcggctgagagagtctggaaggagacgggcata
acgatcgtcgtcgccccccagctggccgacctgaggatgatagctgagagtgttgaaatc
ccagtctttgcacagcacattgacccgataaagcctggaagccacaccggccacgttctt
ccagaggccgttaaggaagtcggggctgtcggaacgctcctcaaccactcggagaacagg
atgattttggccgaccttgaagcggcgataagaagagctgaagaagtcgggctgatgaca
atggtctgctccaacaacccggcggtttcagcggcggtcgctgcccttggcccggactac
gttgccgttgagccgccagagctaatagggaccggaatcccggtcagtaaggcaaagccc
gaggtagtcacgaacaccgtcgagctcgtgaaaaaggtaaaccctgacgttggagtccta
actggagctggcatctccacgggagaagacgtcaagaaggcactcgaactcggaagcgtt
ggggttctcctcgcgagcggcgtcacgaaggccaaagacccagagaatgcgataagggac
ctcgtgtcacttatcatttga

DBGET integrated database retrieval system