KEGG   Tetragenococcus koreensis: C7K43_09355Help
Entry
C7K43_09355       CDS       T05710                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tkr  Tetragenococcus koreensis
Pathway
tkr00480  Glutathione metabolism
tkr00590  Arachidonic acid metabolism
tkr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C7K43_09355
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C7K43_09355
Enzymes [BR:tkr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C7K43_09355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AYW46110
UniProt: A0A3G5F7A9
Position
complement(1937208..1937681)
Genome map
AA seq 157 aa AA seqDB search
MSTIYDFKETEMSGETLDLSDYKGKVVVIVNTASKCGLATQLEALESLYQKYNEQGFEVL
GLPSNQFHQELDDDEQTQDYCKVHYGVSFPMTKRVKVNGNEADPLFTHLKEAAGHGVIKW
NFTKFLVGRDGQVIKRYAPQTKPEKMEEDIIAALKTE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgatttatgattttaaagaaacagaaatgagcggcgaaacgcttgatttgagt
gattataaaggtaaagttgtcgtaattgtaaatactgccagtaaatgtggacttgctaca
caacttgaagcccttgaatctttatatcaaaaatataacgaacaaggctttgaagttttg
ggattgccttctaatcaatttcatcaagaactagatgatgatgagcaaacccaagattat
tgcaaggttcattatggtgttagtttcccaatgaccaaacgggtgaaagtaaatggtaat
gaagccgatccattgtttacccatctaaaagaagcagctggtcacggggtaattaagtgg
aatttcactaaatttctagtggggcgcgacggacaagtaatcaaacgctacgcaccgcaa
actaaaccagaaaaaatggaagaagatattattgcggcgttgaaaacagagtaa

DBGET integrated database retrieval system