KEGG   Pseudothermotoga lettingae: Tlet_0266Help
Entry
Tlet_0266         CDS       T00618                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00620  Pyruvate metabolism
tle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tlet_0266
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tle02000]
    Tlet_0266
Enzymes [BR:tle01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Tlet_0266
Transporters [BR:tle02000]
 Other transporters
  Primary active transporters [TC:3]
   Tlet_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA TAL_FSA URO-D
Motif
Other DBs
NCBI-ProteinID: ABV32836
UniProt: A8F3V2
Position
complement(283847..285139)
Genome map
AA seq 430 aa AA seqDB search
MNFVDTTLRDGHQSLIATRMSTEDMLPALDAIDKVGFYSMEVWGGATFDVAVRFLNEDPW
ERLRKIREKIKNTKLQMLLRGQNLVGYRHYADDTVRLFVRKAVENGLDIIRIFDALNDER
NLLIAIDEAKKSNAHVQGAISYTISPVHTIEYYLEYARKLIELGVDSICIKDMAGLLTPK
DAYNLVSALKKQFSIPINVHSHCTCGLAPATYQAAMDAGADIIDTALSPFALGTSQPPFE
PIYYALSKNGDLPALDWDTLDFLIDHFTRVRQKYAAFDVKMTTIDPKILYAQVPGGMYSN
MVKQLQEQKMAHRMKEVLEEIPRVQKDLGYPPLVTPTSQIVGVQAVLNVMTGERYSKVTK
EVKEYVKGFYGRPPAPIDPELVKKILGDEDVLIYVILGEIGKKYLQKRYINQLKVDFDLL
KDFEAPVYPV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttgtcgatacaactcttagagacggtcatcagtcgcttattgcaacaagaatg
tcgaccgaagatatgcttcctgctcttgatgctatagataaggttggtttttactccatg
gaagtctggggaggagctacttttgacgttgcagtgaggtttttaaatgaagatccatgg
gaaagattgagaaaaatcagagaaaaaatcaaaaatacaaagcttcagatgcttctccgc
gggcaaaacctggttggttatcgccattacgcagatgacacagtcaggctttttgtcaga
aaagctgttgaaaatggcttagacataataagaatattcgatgcattgaacgacgaaaga
aatttgctgattgccatcgatgaagcaaagaaatcaaacgctcatgtacagggagcaata
tcctatacgatcagccctgttcacacaattgaatactacttagaatatgctcgaaaattg
atagaactcggcgttgactctatatgcataaaagatatggcaggcttgctcacgccaaaa
gatgcatacaaccttgtcagtgctctgaaaaaacagttttcaatcccgataaatgtccat
tcccactgtacatgtgggcttgcaccggcaacttatcaggctgccatggatgcaggggca
gatataatagataccgctctatcaccatttgcgcttggtacatcacaacctccattcgag
cctatctattatgctctgagtaaaaatggagatttaccagctttagattgggatacgctc
gattttctcatagaccatttcaccagggtaagacaaaaatacgctgcttttgatgtaaaa
atgacaacaattgatccaaaaattctctacgcgcaggtacctgggggcatgtattcaaat
atggtaaaacaactccaggaacaaaaaatggcccacagaatgaaagaggttttagaagaa
ataccgcgtgttcaaaaagaccttggttatcctccgttagtgacaccaaccagccagata
gttggtgttcaggctgtgctgaatgtcatgacaggcgaaagatactctaaagtaacaaaa
gaagtcaaagaatatgtaaaaggtttctatggacgtccgccggctcctattgacccagaa
ctggtgaagaaaatactcggcgatgaggacgtcctgatatacgtgattctcggagagatt
ggcaagaaatatctccagaaacgttatataaatcaactcaaagttgattttgatctgttg
aaagattttgaggcccctgtttatcctgtatga

DBGET integrated database retrieval system