KEGG   Pseudothermotoga lettingae: Tlet_0382Help
Entry
Tlet_0382         CDS       T00618                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00970  Aminoacyl-tRNA biosynthesis
Module
tle_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tle00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tlet_0382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tle01007]
    Tlet_0382
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tle03016]
    Tlet_0382
Enzymes [BR:tle01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Tlet_0382
Amino acid related enzymes [BR:tle01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Tlet_0382
Transfer RNA biogenesis [BR:tle03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tlet_0382
 Prokaryotic Type
   Other AARSs
    Tlet_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1_2 tRNA-synt_1e zf-FPG_IleRS tRNA-synt_1f Zn_Tnp_IS1595 GAGA tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: ABV32949
UniProt: A8F465
Position
complement(407729..410464)
Genome map
AA seq 911 aa AA seqDB search
MDYRSTLNLPGTEFSMRANLVEKEPRILEKWQKMNIYDYLLKHRENNPTFVLHDGPPYAN
GDIHIGTAMNKILKDIVVRYKTLRGFKSPYVPGWDTHGLPIEHKVTTMLGEKARSMSQTE
LRKACEEFAKQQIEMQKKQFQRLGVIGDWENYYATLNPEYEYKIYEIFAKLVEDGYVYRA
LKPVLWCNNCGTALAQAEIEYHDHDSPSIYVKFKMENSENEYIIIWTTTPWTLPGNTGIA
VHPDQQYVKIEVGSEIWILAEKLLKMAMQEIGIDEYRILEKFKGHFLEGKQAVHPIFDRK
SRIITADFVDMETGTGCVHIAPGHGEEDYEFGHLVNGLAVISPVDEKGYFTEEAGKYSGM
HIEKANKQIIEDLKNNGSLLKESTIKHSYPHCWRCKKPVIFRATEQWFISVEKNNLRQRV
LENIQNVAWIPAWGKNRISAMVEERPDWCISRQRAWGTPIPAFRCSKCSEVVLDARLIRH
FAEIVKKMGTNAWFELSEKQLLPDGYVCPHCGSEDLVKMNDTLDVWIDSGSSFEAVLTTR
PELTFPADMYLEGSDQHRGWFNSSLVLSVITHDKPPYKTVLTHGFIKDAEGKKMSKSLGN
VVDPLEVCSKYGADVLRLWLASSDYFNDIRISKNIIFQQVEVYKKIRNTIRYLLGNLQDF
SVTDSIGFQKMLPVDRWALGRLQQIIKSVTEAYESYEFSKAYNILVKYCSVELSAIYLDI
VKDRLYVEGKHSLKRRSAQTVLYNILKSLLVMFSPILAFTCEEAYEFLNFGEKKYQTVMA
ENWPEYKEEYIDTNLMNDFEELLQLRDLVLKALEESRQNGLIGHSLDAKVAIKTGSKKTL
DLLKKYSAYLEEFFIVSKVEICNSDENLHIEVEHAEGEKCERCWKYDPLTNSDSEFPNIC
PRCMAVLKEKR
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
ttggattacagatccactctcaatcttcccggtactgagttctcaatgcgcgctaatttg
gtggaaaaagaaccgcgtatacttgaaaaatggcaaaaaatgaatatttatgattatctg
ctaaaacacagagagaataacccaaccttcgtccttcacgatggtccaccttatgcaaat
ggcgatattcacataggcactgctatgaacaagatactgaaagatatagttgtgagatac
aaaacacttcgcggatttaaatcgccttatgtacccggatgggatacgcacggtttacca
atagagcacaaagttacgacaatgcttggagaaaaggcgagatctatgtctcaaacagaa
ttgagaaaagcttgtgaagaatttgcaaaacaacagatagaaatgcaaaagaaacagttt
caaagacttggcgttataggtgactgggaaaattattatgcgactttgaaccctgaatat
gagtataaaatctatgaaatttttgcaaagctggtggaggatggctatgtttacagagcg
cttaaaccggttctctggtgtaataattgcggtacagcccttgcacaggcggaaatagaa
tatcacgaccacgattcaccatctatttatgtcaaatttaaaatggagaactcagaaaat
gaatacataatcatctggacaactaccccatggaccctgccgggaaataccggaatagcc
gtccatccagatcaacaatatgtgaaaatagaagtaggaagcgaaatctggatccttgct
gagaaattattgaaaatggccatgcaggaaattggtatagatgagtacaggattcttgaa
aaattcaaagggcatttccttgaaggaaaacaggctgttcatccaatatttgatagaaaa
tctcgcataatcacagccgatttcgtagacatggaaacaggcactggttgcgtgcacatt
gcaccgggacatggtgaggaagattacgaattcggccatctcgtgaatggtttagccgtt
atttccccagttgatgaaaaaggctatttcacagaggaagccggaaaatattctggcatg
catattgaaaaagcaaacaaacagataatagaagatttaaaaaacaatggctctcttctt
aaggaatcaaccatcaagcattcttacccgcactgctggagatgcaagaaacctgttata
ttcagggcaacagagcaatggtttatatctgttgaaaaaaacaacctgaggcaaagggtc
cttgaaaatatacagaatgtggcatggataccagcctggggaaaaaatagaataagtgct
atggtggaagaaagaccagattggtgcatttcgaggcaacgcgcctgggggacacctatt
ccggctttcaggtgcagcaagtgtagcgaggttgttcttgatgcaagattgatcaggcat
tttgccgaaatagttaaaaaaatgggaacaaatgcctggtttgaactcagtgaaaaacaa
ctcctgcccgatggatatgtgtgcccacattgcggttcggaggatcttgttaaaatgaac
gatactcttgacgtatggattgattccggttcttctttcgaggcagttttaaccacaaga
ccggaattaacatttcccgcagacatgtatcttgagggaagcgaccagcacagaggctgg
tttaattcgtcactggtcctttctgtcataacacacgataaacctccgtataaaactgtt
ctaacgcatggattcataaaagatgcagaaggaaagaagatgagtaaatctctcggaaat
gttgtcgatcctcttgaagtatgctctaaatacggtgcagatgtactcagattgtggctt
gcaagcagtgactatttcaacgatatcagaatatccaaaaatataattttccagcaggtc
gaggtttataaaaaaataagaaacactataagataccttctgggaaaccttcaggatttt
tcagtaacagattctatcggattccaaaagatgcttccggtagatagatgggcacttgga
agacttcagcaaataataaaatctgtaacagaggcatacgaaagttatgagttttccaaa
gcatataacatactggtgaagtattgctctgtagaactaagcgctatctatctggatatc
gtgaaagatagactatacgtcgaaggaaagcactctttaaaaagaagatcggctcaaaca
gttttatataatattctaaaatcactgcttgtcatgttctcgccaattcttgccttcacg
tgcgaagaggcttacgagtttctaaactttggtgagaaaaaatatcaaactgtaatggct
gaaaattggcctgaatataaagaggaatacatagacaccaatctgatgaatgattttgaa
gaacttctccaattgagggatctcgttttgaaagcacttgaagaatccaggcagaatggt
ttgataggtcattcactcgatgcaaaggttgctatcaaaaccggctctaagaaaaccctt
gatttactcaaaaaatattcggcatacctggaagaattcttcatagtctccaaagtagaa
atttgcaactctgacgaaaatctacacattgaagttgaacatgccgaaggtgagaaatgt
gagcgctgctggaaatatgatccgctgaccaattcagattcggagtttcccaatatctgc
ccaagatgcatggctgttcttaaagaaaaaaggtga

DBGET integrated database retrieval system