KEGG   Pseudothermotoga lettingae: Tlet_0561Help
Entry
Tlet_0561         CDS       T00618                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tle  Pseudothermotoga lettingae
Brite
KEGG Orthology (KO) [BR:tle00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Tlet_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABV33127
UniProt: A8F4P3
Position
589801..591006
Genome map
AA seq 401 aa AA seqDB search
MVTLIAFGTGVAMAFAIGANDVANSMATAVGAKAITPKQAVLIASVLEFLGAVLFGSHVT
STITKGIVKVDIVNDPNTLMIGALAALISSSVWVLAATFWGMPVSTTHSIVGGMAGFGIA
AGGWNAIHWAKMVSIAMSWVISPLLGGLLAYGVFKLISLLVLRRDNPVRAAKKTGPIIIW
VTFFIIVYLFAVKTVKIGYGKSFVFSFSVSALAMIAGYFLLKRNSQKHNADPYDFVENMF
RRLQVMTSCYVSFSHGANDVANAVGPVVVVYSVIKTGMVSSQIHTPIWILFLGGLGISMG
VLFLGYRVMKTIGSDITPLTNTRGFCIDFSTASTVLMASVLGFPVSTTHIVVGSVVGVGM
ARGIEVVNVGVLKNIVLSWLFTVPLAAVFSAILFKLFTLII
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggttacattaattgcgtttggaacgggcgttgctatggcatttgccataggagcaaat
gatgttgctaattctatggcaacggcagtgggagcaaaagcaattactccgaaacaggct
gttttgatagcgtctgttttggaattcttgggagcagttttatttggatctcacgtgacc
tccacaataacgaagggaattgtcaaggtagatattgtgaatgatccaaatactctgatg
ataggtgctcttgcggctcttatctcatcatctgtttgggttctggcggcaactttctgg
ggtatgcctgtttcaacaacgcattccattgttggcggaatggctggttttggaatagct
gctggtggatggaatgcaatacactgggcaaagatggtatccattgcgatgagctgggtg
atttctcctctgcttggaggactgcttgcttacggagtattcaaattaatatcactttta
gtgcttcgtagagataatcctgttcgagccgccaaaaaaaccgggcctataataatctgg
gtcacatttttcataattgtgtacctgtttgcagttaagactgtgaaaattggttatgga
aaaagcttcgttttctctttttccgtttctgcactggctatgatcgcaggttattttctt
ctcaaaagaaattctcaaaaacacaacgcggatccttatgatttcgtcgagaacatgttc
agacgacttcaagttatgacaagctgttatgtgagtttttcgcacggtgctaacgatgtt
gcaaatgcggttggccctgtggtagtcgtttattctgttattaagacagggatggtctct
tcacaaatacatacaccaatctggatacttttccttggaggccttggaatttctatgggc
gttctatttcttggatatagagttatgaaaaccattggcagtgatataacccctctgacc
aatacgcgtggcttttgtatagatttctctacagcttctaccgtcttaatggcttcggtc
cttgggttccctgtttcgacaacacacattgttgtcgggtctgtggtaggtgttggaatg
gcccgcggcattgaggttgtcaacgtcggggtgttgaaaaatatcgtgctttcgtggctt
tttacagttccacttgccgcagtattttcagcgattttgttcaaattgttcacgctaatc
atttaa

DBGET integrated database retrieval system