KEGG   Pseudothermotoga lettingae: Tlet_0610Help
Entry
Tlet_0610         CDS       T00618                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00010  Glycolysis / Gluconeogenesis
tle00052  Galactose metabolism
tle00500  Starch and sucrose metabolism
tle00520  Amino sugar and nucleotide sugar metabolism
tle00521  Streptomycin biosynthesis
tle01100  Metabolic pathways
tle01110  Biosynthesis of secondary metabolites
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
tle01200  Carbon metabolism
Module
tle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0610
   00052 Galactose metabolism
    Tlet_0610
   00500 Starch and sucrose metabolism
    Tlet_0610
   00520 Amino sugar and nucleotide sugar metabolism
    Tlet_0610
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tlet_0610
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tlet_0610
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tlet_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABV33176
UniProt: A8F4U2
Position
625474..626424
Genome map
AA seq 316 aa AA seqDB search
MKVIGIDLGGTNYAVGLVDETGNILSRIEGKTKVDEGPQAVAKRLSESVKSVMSNTGVSA
RAIGIGSPGSIDHEKGVVRFSPNFPGWYNFPLAEEIRTHTGLDVFIENDANAYALGEHTF
GVARGFDHVICLTLGTGIGGGVITHGFLLRGSVGIGAELGHMNVLPNGPKCGCGSNGCLE
SLASATAIRKYVEDGYSRHIDSSLFKEKNASQITPKDVFEHAKNGDYFSLSVFNRVVSAL
SVAIGSLINIFNPQVVVIGGGMANAGDFLLEPVEEMVKDYVLPTMLGTYQIKLSQLGKNA
GILGAASIVFERASKR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagttatagggatagatttgggaggaacaaattacgcagtaggtcttgttgatgaa
acaggaaatattttatctcgcatcgaaggaaaaacgaaggtggatgaagggccgcaggct
gtcgcaaaaaggctttcggaatctgtaaagtctgtcatgtcaaataccggtgtttcagct
cgagctatcgggattgggtcaccggggagtatagatcatgagaaaggtgtggtcaggttt
tcgccaaatttccctggctggtacaattttccgcttgctgaagaaatcaggacccatacg
ggtttagatgttttcattgagaacgacgccaatgcttacgcgctgggtgaacatacattc
ggtgtggccagggggtttgatcatgttatttgtctcacgctgggtacaggcatcggtggt
ggggttataactcatggatttttactcagaggaagtgttggaataggggcagaactggga
catatgaatgttttaccaaatgggccaaaatgcggttgtggctctaacgggtgtcttgaa
tcactggcgtctgcgacggctataagaaaatatgttgaagatggatattcaagacatatc
gactcttctctttttaaagagaaaaacgccagccaaataactcctaaggacgttttcgag
cacgcgaagaatggagattatttttcactatccgtttttaacagagttgttagtgccctt
tcggtggcaataggaagtttaatcaatatttttaatcctcaggtagtagttattggtggt
gggatggcaaatgccggtgattttctacttgagccagttgaagaaatggtaaaagactat
gtactaccaaccatgcttggaacgtatcagataaaattgagccaacttggcaagaatgca
ggtattcttggggcagcttctatagtttttgagagggcgagtaaaagatga

DBGET integrated database retrieval system