KEGG   Pseudothermotoga lettingae: Tlet_1476Help
Entry
Tlet_1476         CDS       T00618                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tle  Pseudothermotoga lettingae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 BAG
Motif
Other DBs
NCBI-ProteinID: ABV34032
UniProt: A8F798
Position
complement(1543468..1544487)
Genome map
AA seq 339 aa AA seqDB search
MYLKQLTELDGVSGNEEKVRKFIEKEIEKYVDELKVDILGNLIACKKGTKSKRKIVIAAH
MDEVGFMVTNVEDDGMLCFAPVGGVETQVMPGKVVRINGEIPGVIGFKAIHIQERDQILK
PPSVDQMRIYIGAKSKEEASKMVKIGDYVSFTTGYHQENGRATGKAFDDRAGCSVLMDII
TLDNRYEDDVYFAFLVQEEVGLRGSAVVVEQIHPDIAIVIEGTTAGDDPELPSYQWATHL
GEGPAVTFMHRGYVINKRVYESILKLAEKYSIPYQAKRRTAGGTDAARFARTGAGTAAGV
ISVPARYIHSPVSMIDLNDYKNTVLLVEKILEEGEAFAK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgtacttgaagcagcttaccgagcttgatggagtttctggaaatgaagagaaggtcaga
aaattcatagaaaaagagatagaaaaatatgttgatgaactgaaggtggatattcttgga
aacctgattgcctgtaaaaaaggtacaaaaagcaaaaggaaaatagtaatagcggctcac
atggacgaagtcggctttatggtgacaaacgttgaagatgatggaatgctctgctttgcg
cctgttggcggggtagagactcaagtaatgcccggaaaagttgtcagaatcaatggagaa
atccccggggtaataggtttcaaagccatacacattcaggaaagagatcagattttgaag
ccaccatcggtggatcagatgaggatctacattggggcaaaatctaaggaagaagcttcg
aagatggttaaaataggggattatgtatcttttacaacaggttatcaccaggagaacggc
agagccacgggaaaagcttttgatgatagagcaggatgctctgttttgatggacatcatt
actctggataatcgttatgaagatgatgtttattttgcctttcttgttcaggaagaagtt
ggattgcgtggaagcgcagttgttgtggagcaaattcatcctgatattgcaatagttata
gaaggaacaacagcgggtgatgacccggagttgccttcttaccaatgggcaactcatctt
ggtgaagggccggcagttacatttatgcacagagggtatgtaatcaacaaaagagtttat
gaatcaatcttaaagctggcagagaaatactccataccataccaggcaaaaaggcgaacg
gccggaggtacagatgcggcacgttttgcaaggacaggcgccggcaccgcagctggagtg
atatctgttccagcacgttatatacacagtcctgtttcaatgattgatttgaacgattat
aaaaatacggttcttctggttgaaaaaatacttgaggaaggggaggcatttgcaaaatga

DBGET integrated database retrieval system