KEGG   Pseudothermotoga lettingae: Tlet_1942Help
Entry
Tlet_1942         CDS       T00618                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00260  Glycine, serine and threonine metabolism
tle01100  Metabolic pathways
tle01110  Biosynthesis of secondary metabolites
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
tle01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlet_1942
Enzymes [BR:tle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Tlet_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1 PALP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABV34496
UniProt: A8F8L2
Position
2017799..2018815
Genome map
AA seq 338 aa AA seqDB search
MIDLRSDTVTTPTEKMRRSMFEAEVGDDVYQDDPTVNKLQELAAEKIGKEAALFVPSGTF
GNQLAIFTHTLRGDEVIVPSSNHIFVHEVGAPAVISNVQLRTIDDPYGMPSIDKIAKAIR
NEDIHNPRTGLICMENAHSSGKVIPIDYLENVHKLARKCSIPVHLDGARIFNAAIALNVD
AKQIASSADSVMFCLSKGLSAPVGSILAGTKDFVAKARKGRKLMGGGMRQAGVLAAAGII
ALNEMIDRLAEDHENAKLLANLLDEIPQIHVLKDQLDINMVFFSFNTIEPEIFVGKMLEN
GVKINPPHEGIYRFVTHKDISKEDIYTVVKIIKRIVKI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaccttcgaagcgatactgtcacaaccccaacagagaaaatgagaagatcaatg
tttgaagcagaagttggagatgatgtgtatcaggatgaccccacagttaacaaattgcag
gaactcgcagccgaaaaaataggcaaggaagctgccctttttgttccgtctggcaccttt
ggaaatcagcttgctatattcacccatacactcagaggagatgaagtcatagtgccttct
tcaaaccacatttttgttcatgaagtgggcgcacctgccgtaatatcaaatgttcaactt
cgaacaatagatgatccttacggtatgccctccatcgataaaatagcaaaggcaataaga
aatgaagacatacataatccaagaacaggcttgatttgcatggagaacgctcattcaagt
ggaaaagtaataccgatagattatttagaaaatgttcacaaacttgcgagaaaatgctca
ataccggttcatttagatggtgcaagaatatttaatgcagctattgcattaaatgtagat
gcaaagcaaatagcttcaagtgccgactcagttatgttctgcttatccaaaggactttct
gctccagttggatcaattctggcaggtacaaaagattttgtcgcgaaagccaggaaggga
agaaaattaatgggtggaggaatgagacaggctggagttctcgctgctgccgggataata
gcactgaatgaaatgatagacagacttgccgaagatcatgaaaatgcaaagttgctggca
aatcttctagatgaaatccctcagattcacgttttgaaagatcagctcgatataaacatg
gtgtttttcagttttaataccattgaaccagaaatttttgttggtaaaatgttagaaaat
ggcgtgaaaatcaatccacctcatgaaggcatatacagatttgtgactcacaaagatatt
tcaaaagaagatatttacacagttgtgaaaattataaaaaggatagtaaaaatctga

DBGET integrated database retrieval system