KEGG   Pseudothermotoga lettingae: Tlet_1950Help
Entry
Tlet_1950         CDS       T00618                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00010  Glycolysis / Gluconeogenesis
tle00030  Pentose phosphate pathway
tle00051  Fructose and mannose metabolism
tle00052  Galactose metabolism
tle00680  Methane metabolism
tle01100  Metabolic pathways
tle01110  Biosynthesis of secondary metabolites
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_1950
   00030 Pentose phosphate pathway
    Tlet_1950
   00051 Fructose and mannose metabolism
    Tlet_1950
   00052 Galactose metabolism
    Tlet_1950
  Energy metabolism
   00680 Methane metabolism
    Tlet_1950
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tlet_1950
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tlet_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Ribosomal_S5 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABV34504
UniProt: A8F8M0
Position
2026225..2027487
Genome map
AA seq 420 aa AA seqDB search
MSGKVGILVGGGPAPGINSVINAVTIEAINNGLEVVGIYDGFEHLMKAQTTFVRHLTISD
VSRIHIEGGSILRTSRANPTKKAEDLQNVVRALKELQVRYLVTIGGDDTAFSASSVMKVS
NGALRVAHVPKTIDNDLPLPGGMPTFGFETARHVGTELVYNLMQDSRTTNRWYFVVVMGR
KAGHLALGIGKAASAALTVIGEEFRKERIKLSEVCDLLEAAIIKRKALGRNDGLAVIAEG
IGEMIDPKELASIPGVVVETDPHGHIRLSEIPLATILKREIQKRFAQRDEKINIIDVTLG
YELRCARPTPFDIDYTRTLGYGAMRFLLGEYEENLTGGMVCLDNGRIRILPFEELIDPST
GRTKVRMVDINSEHYRVARSYMIRLTRKDLQDEEMLSRLTRVARISREEFLEKFSKVAEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgggaaagtcggaattctcgttggtggaggtcccgcaccaggcatcaatagcgtg
atcaacgccgtgacaattgaagccattaacaatggcttggaggtagtgggtatttacgac
ggtttcgagcacctgatgaaagcacaaacgacctttgtccgccatttaactatttcagat
gtctctcgcattcacattgaaggaggttctatcttaagaacatcgcgcgcaaatcccaca
aaaaaagctgaggatctgcaaaatgtcgttagagctcttaaagaactgcaggtgaggtac
ctggtcacaataggtggggatgataccgcattttcagcttcatcagtgatgaaagtgagc
aatggagcactacgtgttgcacatgttccgaaaactatcgataacgatctaccactccct
ggaggcatgccaactttcggttttgaaacagcacgccatgttggaacagaacttgtctat
aacttgatgcaggattcaagaactacaaacagatggtatttcgtcgtagtaatgggaaga
aaagcaggtcatttagcgctcggtataggtaaagcagcaagcgcagcattaaccgttatt
ggagaagaattcagaaaggaaaggataaaactttctgaagtatgtgatctgcttgaggca
gctataataaaaagaaaagcactggggcgtaacgatggtttagcagtaatagctgaagga
ataggagaaatgatcgatccgaaagaacttgcaagtattcccggcgtagtagttgaaact
gatccgcatggtcatataagactgagcgaaattcctcttgcaactattctcaaaagggaa
attcagaaacgtttcgctcagagagatgaaaagataaatataatcgacgtgacacttgga
tatgaactcagatgtgcaaggccaacacccttcgatattgattacacaagaaccttaggt
tacggagcaatgcgatttttacttggagaatatgaagaaaatttgactggtggtatggtg
tgccttgacaatggaagaattagaatactgcctttcgaagaacttatagatccatccacc
ggtaggacaaaagtccgtatggtagatataaattctgagcactatagagttgcacgcagc
tacatgatcagattaaccagaaaagatttacaagatgaagaaatgctgtccagactaacc
agagtcgccagaataagcagagaagaatttcttgaaaaattctcaaaggtcgccgagata
tga

DBGET integrated database retrieval system