KEGG   Thermovirga lienii: Tlie_0295Help
Entry
Tlie_0295         CDS       T01644                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
tli  Thermovirga lienii
Pathway
tli00220  Arginine biosynthesis
tli00250  Alanine, aspartate and glutamate metabolism
tli00471  D-Glutamine and D-glutamate metabolism
tli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tlie_0295
   00220 Arginine biosynthesis
    Tlie_0295
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Tlie_0295
Enzymes [BR:tli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Tlie_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AER66034
UniProt: G7V6S5
Position
complement(314712..315629)
Genome map
AA seq 305 aa AA seqDB search
MLQAMNEALARGKKVLHLGQVATYIPELGKADPNTLAIATCTLDGKISQVGDVDKKATIQ
SISKIASLGLAISELGEEKVFSKVGVDPTADPFNSIMRLEMRKPHRPQNPLINAGAIVVL
SILPYHDSNSRFLAVLNLVRKLCGNEKIEANEQVYLSEKATSDRNRSLAYFLRSVGAMEG
DIEDILDSYFHQCGIECSVKDLAVMGATLANDGINPITNEKVLSPRVCVLIRALMATCGL
YDGSGEFAVRVGIPAKSGVGGGIVGAVPGKMGVATLGPALDDKGNSVGGIEAMEYLSEKL
KLRVL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggccatgaatgaagccctggcaaggggcaagaaggtgcttcacttaggacag
gtagcaacgtatatccccgaattaggcaaggcggaccccaataccttggcgatagctacg
tgtacccttgacggcaagataagccaagtgggcgatgtggacaagaaagcaacgattcag
tccatttcaaagatagcatcgctagggctggccatctccgaactcggagaggaaaaggtc
ttctccaaggtgggcgtagaccccacagccgatcccttcaactccataatgcgccttgag
atgcgaaaaccccacaggccacaaaacccactcatcaacgctggcgccatagtggtcctc
tctattctcccatatcatgacagtaacagtcgttttctggcagtgctcaacctggtcagg
aagctttgcggcaatgagaagatagaagccaacgaacaagtatatctatcagaaaaggcc
acaagcgaccgaaacaggtccctggcgtatttccttcgcagcgtgggcgccatggagggg
gatatagaggacatcctggacagttacttccaccaatgcggcatagagtgttcagtaaag
gatcttgccgtcatgggggcgaccttggcaaacgatggtataaaccccataacaaacgaa
aaagtactaagcccaagggtttgcgttctaataagagccctcatggccacatgtggcctt
tatgatggatcaggagaatttgcggtcagagtaggcatacctgccaaaagcggtgtggga
ggcggaatagtaggggcagtgccagggaagatgggagtagcaaccctgggtcccgccctg
gacgacaaaggaaactcagtaggcggaatagaggcaatggaatacctttcagaaaagctc
aaattgagggtgctataa

DBGET integrated database retrieval system