KEGG   Thermovirga lienii: Tlie_0773Help
Entry
Tlie_0773         CDS       T01644                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tli  Thermovirga lienii
Pathway
tli00620  Pyruvate metabolism
tli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tlie_0773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tli02000]
    Tlie_0773
Enzymes [BR:tli01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Tlie_0773
Transporters [BR:tli02000]
 Other transporters
  Primary active transporters [TC:3]
   Tlie_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AER66506
UniProt: G7V9F6
Position
810732..812228
Genome map
AA seq 498 aa AA seqDB search
MEPREKKNIKKDSVKGTSGVVIEEKEQVEIKPPKEKRKVGITETALRDAHQSIMATRLRT
KDMLPVAELMDEVGYHSLEVWGGATFDACMRFLDEDPWQRLRELRKRFKKTKLQMLLRGQ
NLVGYRHYADDVVREFVKRAVSNGLDIIRVFDALNDLRNMEVAADQIKKEGCHLQMCISY
TISPVHSLESFAKLSLEMKGMGADSICIKDMAGLLSPVDAFNLVKAIKERTSLPVQVHCH
YTSGMASMAYFAALEAGADVVDCAISPLAMGTSQPATEAIVAALKGGDLDTGIDLKKLVP
VAEHFKKVKEENRNLVMGIEGVDVNVLIYQIPGGMYSNLVSQLKEQNALDKLQDVLEEVP
KVRKEMGYPPLVTPTSQIVGTQATLNVLTGKRWKIVPKEVKNYFLGFYGRPPGEMDEDIK
KIVIGDDKPIESRPGEILEPELEKAREVIKPWMVEPEDVLSYVLFPAVAKDFLIRKYARA
TKRDVGFEEALEGVAYPV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggagccgagagaaaagaaaaacattaagaaagatagcgtgaagggtacatctggtgtt
gtaatagaggaaaaggagcaggtggaaataaagcctccaaaggaaaaaaggaaagtagga
ataaccgagacggctttaagagatgctcatcaatccataatggccacgaggttacgtact
aaggacatgctaccagttgcggagctgatggatgaagtaggctatcactccttggaagtt
tggggtggtgccactttcgatgcttgtatgcgctttttggacgaggacccatggcagcgc
cttcgagagctcagaaaaaggttcaagaagaccaagttgcaaatgctcttgagagggcag
aatctagtaggttatcggcattatgcggatgacgtggtccgtgagtttgtgaaaagggcc
gtgagcaacgggttggacatcataagggtgtttgatgccctgaatgatttgaggaatatg
gaggtcgctgccgaccagatcaagaaggaaggttgccacctacagatgtgcatatcatat
accatctctcccgtgcattcgttggaatccttcgcgaagctttcgttggagatgaaaggg
atgggagcggattccatatgcattaaagacatggccggacttttaagccctgtagatgcg
ttcaatttggttaaggcgataaaagaaagaacttctctgccagtgcaggtgcattgccac
tatacgagtggaatggcttccatggcttacttcgcagccttagaggctggggcagatgtt
gtggactgtgccatatcgcctttagcaatgggcacaagccagccagctaccgaagcgata
gtggctgctttgaaaggtggcgacctggatactgggatagaccttaaaaagttggtccct
gtagcggagcacttcaaaaaggttaaggaagagaataggaacctcgtaatggggatagaa
ggggtggacgtaaacgttctaatataccaaatccccggggggatgtattcgaaccttgta
agccagctgaaggagcaaaatgctctggacaaattgcaggatgtattggaagaggtgccc
aaggtcagaaaggaaatgggttatcctcctcttgttactcccactagccaaattgttgga
actcaggcaacattgaacgtcctgacgggtaaaagatggaagatagttcccaaggaagtt
aaaaactactttttaggtttttacggaaggcctccgggtgaaatggatgaggacataaag
aaaatagtgattggcgatgataaacccatagagagccgcccgggagagattctagagcca
gagctcgaaaaggcaagagaggttatcaaaccttggatggttgagccggaggatgtccta
agttatgttcttttccctgcggtggccaaagatttcttgatcagaaaatatgcgagagcg
acaaaacgggacgtaggttttgaggaggccctagaaggggtagcctacccagtgtga

DBGET integrated database retrieval system