KEGG   Thermovirga lienii: Tlie_1551Help
Entry
Tlie_1551         CDS       T01644                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tli  Thermovirga lienii
Pathway
tli00030  Pentose phosphate pathway
tli01100  Metabolic pathways
tli01120  Microbial metabolism in diverse environments
tli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlie_1551
Enzymes [BR:tli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tlie_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AER67273
UniProt: G7V7F7
Position
1612119..1613906
Genome map
AA seq 595 aa AA seqDB search
MYCRMLVVDLSMERSWVEEIEEEAIKKYIGGKGLGIYLLDKMLPKGTPPLEKENVLLFLT
GPLTGTSFPTSGRFVVATKSPLTNMYVDSHAGGHFAPAMRRAGFEVLVIKGRASKPSYIW
IDDDRIEIREAQHLWGMQVDETVEAVRNETSHEAHVATIGPAGENLLPIATITFDKDSDP
WRAGVAGRAGTGSVMGSKNLKAVALRGSKSIPIKDETNLRKLTSEIARLAMESPAIHRRR
TVGTSALVEPMSRTGILPSYNFRQGYFHPIYGLTSANLRYHTKRDVACFNCPIVCGKILD
GGGKDTKVEYESIALLGSNDGIGSMPELAKAISVCNQMGMDTISAGGIVAFAMECKDRGI
LHEAPSFGDAEGQRKLLEDIAFRRGLGAILADGVKEASKRIGKGTEEFAIEVKGLELPGY
DPRATWGMALAYATSDRGGCHQRAWTVLAELDGILPRFGTEGIALKVKTTQDERAAAFSL
VVCDFLPYDQNVIYPCLEHAAGLEMSEKEYLEAGERIWNHIRMFNIREANISRKDDYLPK
RMYHDPIPMPPRGEDKVSLPKELFDKMLDEYYMLRGWNEDGIPEEGTLGRLGLSW
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtactgtagaatgttggtagtggacctttcaatggaaagatcctgggtagaagaaatc
gaagaagaagcgatcaaaaagtacataggtggaaagggcttgggaatctatttgctggac
aaaatgctgcccaaaggaacgcccccactcgaaaaagaaaatgtactacttttcctcacc
ggccccctaactggaacatcttttccgacctcaggaaggttcgtcgtagcaacaaagtca
cctctcaccaacatgtacgtagacagtcacgctggaggacactttgctccggctatgcga
agggcaggcttcgaagtgctggtaataaagggcagagcatccaaaccatcctacatttgg
atagacgacgacaggatagaaataagggaggctcagcacctttggggcatgcaagtagat
gagaccgtggaagcagtaagaaatgagacatcccatgaagcccacgtggcaactatagga
cctgcaggggaaaacctacttcccatagctactataacttttgacaaggacagcgatcca
tggagggctggcgtagccggcagagcaggcactggatctgtcatgggaagcaaaaacctg
aaggccgtggccttgagaggctcaaaatctattcccatcaaagacgagacaaacctaagg
aaactcacttcagagatagctcgcctcgctatggaatcccctgcaattcaccgcaggcga
actgtgggcacctccgcactagtggagcccatgagcagaacaggcatactaccctcctac
aatttcaggcagggttatttccatcccatctacggcctgacatcagcaaacctaaggtat
cacacaaagagagatgtagcatgcttcaactgccccatagtatgtgggaaaatactcgat
ggaggagggaaagacacgaaagtagaatacgaatccattgctcttcttggaagtaacgat
gggatagggtccatgccggaactagccaaagccatctcggtctgcaaccaaatgggcatg
gataccatatccgcagggggcattgtagccttcgcgatggaatgcaaggaccgcgggata
cttcacgaagctccatctttcggcgatgccgaaggtcaacggaaactacttgaggacatt
gctttcagaagagggttgggagccatcttggcagatggagtaaaggaagcctctaaaagg
ataggaaagggaaccgaagagtttgccattgaggtaaaaggattggagcttcctgggtac
gatcccagagcaacgtggggtatggccttggcctacgcaacctccgacaggggtggatgt
caccaaagagcatggaccgttctagcggaactagacggcatacttcccaggtttggaacc
gagggcattgccctaaaagtcaaaaccacccaagacgagagggctgcggcgttctccttg
gtggtatgcgatttcctcccctatgaccaaaacgtcatatatccgtgccttgagcatgct
gccggccttgaaatgagcgaaaaggagtatttggaagcaggagaaaggatatggaatcac
atacgtatgttcaacatacgagaggccaacatatcccgaaaggacgactatctacccaag
cggatgtaccatgaccccatccccatgccacctagaggagaagacaaagtgagtttaccc
aaagagcttttcgataagatgttagatgagtattatatgttacgaggatggaacgaagat
ggcatcccagaggaagggacattgggacgtctaggactctcttggtga

DBGET integrated database retrieval system