KEGG   Thermovirga lienii: Tlie_1669Help
Entry
Tlie_1669         CDS       T01644                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tli  Thermovirga lienii
Pathway
tli00300  Lysine biosynthesis
tli01100  Metabolic pathways
tli01120  Microbial metabolism in diverse environments
tli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tlie_1669
Enzymes [BR:tli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tlie_1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 RsbU_N
Motif
Other DBs
NCBI-ProteinID: AER67391
UniProt: G7V860
Position
1736172..1737425
Genome map
AA seq 417 aa AA seqDB search
MERFENVYGEVENLKGAMLETLAEMIKIPAISPNYGYEGEYDKAEKLLEIIKDWPFDKIE
RYDAPDERAKNGVRPNILAYYYGKDHDESSRLWVLSHLDVVPPGDLEKWTITDPFTPLIK
DDKIYGRGSEDNGQSIVSSLYAVKALMNLGLRPKKTVVLAFVSDEETGSEKGLKWLMENH
SELFRKDDLVIVPDGGNVDGSFIEVAEKSILWLRIKVVGKQVHASMPQKGMNAHRIALNL
AYKLDKAFHEKYNAKDELFEPAISTFEPTMASNPADSPNIVPGEHTFIFDCRVLPNYKID
DILADAHNIAEELKKEFQDENLPEIHFEVLQRLDAPIPTDPNSKIVQSLKEALINLRGTN
PKIGGIGGGTFAAHFRKLGIPAVVWATLDEMAHQPNEYAKISNIVEDAKTIAYLAIN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatttgagaatgtttacggcgaagtcgaaaacttgaagggggccatgctggaa
acactggcagagatgataaaaattcccgccataagccctaattacggttacgaaggagaa
tacgacaaagcagagaagttgcttgaaataataaaagactggccttttgacaagatcgag
cgctacgatgctcccgacgaaagggcaaaaaatggagtaagacccaacatcctggcatac
tattatgggaaagaccacgatgaaagctccaggttgtgggtgttgtcccacctcgacgtc
gtcccgccaggagatttggagaaatggaccataactgaccccttcacgcctttgatcaag
gacgacaaaatctacggcagggggagtgaagacaacggccaaagcatcgtctcatctcta
tatgctgtaaaagcgctgatgaaccttggtttgcgccccaaaaagactgtggtgctcgcc
ttcgtgagcgatgaggagacaggaagcgaaaaaggcctgaaatggctaatggaaaaccac
tcagagctcttcaggaaagatgacctagttatagtgcctgacggaggcaacgtcgacggc
tcctttatagaggtagcggaaaagagcatactatggttgaggatcaaggtggtgggcaaa
caggtccatgcaagcatgccacaaaagggcatgaatgcccatagaatagcgctgaacctc
gcctacaagctagacaaggcctttcacgaaaaatacaacgcaaaagatgaacttttcgaa
cccgccatctcaacctttgaacccactatggcatccaatccagcggactcaccaaacatt
gtgccaggagaacatactttcatcttcgactgcagggttctacctaactacaagatagac
gatatcctcgcagacgcccataacatagcggaagaactaaagaaagaattccaggatgaa
aaccttcccgagattcactttgaagtgcttcagaggctggatgctcccataccaacggat
ccaaactccaagattgtccaatctctcaaagaggctttaattaatctgcggggcacgaat
cccaagatagggggaataggtggcggaaccttcgcggcccacttcagaaagctgggcatt
cctgccgtggtgtgggcgaccttggacgagatggcccaccaacccaatgaatatgcaaag
atttcaaacatcgtcgaggacgcaaaaacaatagcctatctagccataaattaa

DBGET integrated database retrieval system