KEGG   Thermovirga lienii: Tlie_1893Help
Entry
Tlie_1893         CDS       T01644                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
tli  Thermovirga lienii
Pathway
tli00020  Citrate cycle (TCA cycle)
tli00620  Pyruvate metabolism
tli00650  Butanoate metabolism
tli01100  Metabolic pathways
tli01110  Biosynthesis of secondary metabolites
tli01120  Microbial metabolism in diverse environments
tli01130  Biosynthesis of antibiotics
tli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tlie_1893
   00620 Pyruvate metabolism
    Tlie_1893
   00650 Butanoate metabolism
    Tlie_1893
Enzymes [BR:tli01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Tlie_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF BCA_ABC_TP_C
Motif
Other DBs
NCBI-ProteinID: AER67602
UniProt: G7VAF2
Position
pTLIE01:7133..8644
Genome map
AA seq 503 aa AA seqDB search
MELHERIRSKVLREKVVSKEEAAKFIKDGMTVACSGFTPAGYPKVVPEMIAQRAQKGENI
RLNIITGASTGDELDGVLARSGVIKKRYPYQTNTDCRNGINSGQIDFCDIHLSHLPQFIK
LGYLGNIDIALVEAVAITEDGGIVPSTSVGATNTFVQKADKVIVEINFAQPLDLEGLHDI
YDPGDPPLRSPIPLCRVSDRIGIPYIPCPKEKIVAIVISNRKDSTNPVAEIDRDSRLIAG
HIIDFLEFEIKKGRFPKNLLPLQSGVGSVANAVLTNFKESRFENLEIYSEVLQDAVLELI
DTGKVSFASGTAFTISPSKLDHFYKNLKFYKNYTILRPQEISNNPEVIRRLGVIAMNTAI
EIDIYGNVNSTHIGGCAMMNGIGGSGDFTRNAALSIFTTKSVAKDGNISSIVPMVSHHDH
TEHDVHVVVTEQGLADLRGLSPKERVKQIIGKCAHPDFRKELWDYYRKALFYAKYKHTPH
MLNRVFDLHNYMVKYGTMKPKVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttggagcttcatgaaagaataagaagtaaggttttgagagaaaaagtggtatcgaaagag
gaagcggcgaaattcatcaaagatggaatgaccgtagcatgtagcggttttactccagca
ggctatcccaaggtcgtacctgaaatgatcgcccaaagagcccagaagggtgaaaatata
agactaaacatcattacgggcgcctcaacaggagatgaattagacggagttctcgcaaga
agtggcgtcattaagaaacgatacccttaccaaacaaacaccgactgcagaaacggcata
aactcgggacagatagatttttgcgatattcatttgagtcatttgcctcaatttataaaa
ctaggatatctaggtaatattgacatagccttagtagaagctgttgccatcacagaggac
ggcgggatagttccatccacctctgtgggagcgacgaacaccttcgttcaaaaagcagac
aaagtaatagtggaaataaattttgcccaaccgctggatttggaaggccttcacgatata
tatgaccctggggaccctcccttaagatcgccaatacctctgtgcagagtttccgataga
ataggaataccatatatcccttgtccgaaagaaaaaattgtcgcaattgtaatctcaaac
cgaaaggattctacaaaccccgttgcggagatagatagagattccaggcttatcgcaggc
cacataattgattttcttgaatttgaaatcaaaaaaggaagattccccaaaaatttactc
cctctacaatccggcgtaggtagtgtggccaatgcagtactaaccaacttcaaagaatcc
cgttttgaaaatttagagatatactcagaagtcctgcaagacgccgtgctggagttgatc
gatacaggaaaggtatcctttgcatctgggacagcctttacaatctctccctcaaaattg
gaccacttttataaaaacttaaaattctacaagaactacaccatcctcagaccccaggag
ataagcaataaccctgaagtaattcgtcgcctcggagtaatagcaatgaacactgcaata
gaaatagatatatatggcaacgtcaactctactcatataggtggatgcgcaatgatgaat
ggaatcggagggtctggtgacttcaccagaaacgctgcattgtccatctttacaactaag
tctgtggccaaagacggcaatatatcctccatagtacccatggtgtcccatcatgatcac
accgaacatgatgtacacgtcgtcgtaacggaacaaggtttagccgatctgagaggcttg
agcccaaaagaaagggtcaaacaaataatcggcaaatgcgcccatccagatttcaggaag
gaattatgggattactacaggaaagctcttttttatgccaaatataaacatactccccac
atgttaaatagagttttcgatttacacaactatatggttaaatatggtaccatgaaaccc
aaagtctgctaa

DBGET integrated database retrieval system