KEGG   Thermococcus litoralis: OCC_01444Help
Entry
OCC_01444         CDS       T02800                                 

Definition
(GenBank) epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00520  Amino sugar and nucleotide sugar metabolism
tlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OCC_01444
Enzymes [BR:tlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     OCC_01444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: EHR79152
UniProt: H3ZLL4
Position
893800..894810
Genome map
AA seq 336 aa AA seqDB search
MMDLIRSDVRDIVRALDRADFKGKIALVTGGAGFLGSWLCDVLIELGARVYCVDNFASGR
WENISHLASEENFVFIEHDVSKPLEIKEKLDYIFHFASRASPFEFEHYPLEIIDANTLGT
RNMLELARKNDARFIFASTSEIYGQPDVVPTPETYWGYVNPIGIRSCYDESKRLGETITM
AYHRQYGVDVRIVRIFNTYGPRMRADGVYGRVVPRFISQALNREPITVFGDGSQTRSFCY
VTDLITGVLKFAVLENGNGEVVNLGNPREVSILELAHIIKKLTNSDSPIEFHPLPPDDPP
RRCPDISKAQKLLNWKPKVELEEGLKKTIEWYKGEI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttgataaggtcagatgtaagagacattgtaagagcattagatagggctgat
tttaagggtaagattgccctagttactggtggtgctgggtttttgggttcttggctttgc
gatgttttaattgagcttggggcaagagtttattgtgttgataactttgcaagtggtcgt
tgggaaaacatctctcatctagctagtgaggagaatttcgtatttatagagcacgatgtt
tcgaaacccttggagattaaggaaaagttagattatatttttcacttcgcctcaagggca
tcaccctttgagtttgagcactatcccctagagataatagacgcaaacacccttgggacc
aggaacatgctcgagttagctaggaaaaacgatgcccgctttatctttgcctcaacgagc
gaaatttatggtcagcctgatgttgttccaactcctgaaacatactggggttacgtgaac
ccaattggcattaggagttgctacgatgagtcgaagaggctcggagaaaccatcactatg
gcgtatcatagacaatatggagttgacgttagaatagttagaatattcaacacttatggg
ccgagaatgagggctgatggagtttatggtagggtagtcccaaggtttataagccaagcc
ttaaatagggagccaattacggtttttggagatggaagccagacgagaagcttctgctat
gttactgatcttataacgggagtgttgaagtttgccgttttggagaatggtaatggggaa
gttgtgaatttagggaatcctagggaggttagtattcttgagcttgctcatattataaag
aagcttactaattctgattcgccgatagaattccacccactgccaccggatgatccccca
agaagatgcccagatattagcaaagcacaaaaactgctaaactggaaaccaaaggtcgaa
ctcgaagaagggctcaaaaagacaatagagtggtataagggggaaatttag

DBGET integrated database retrieval system