KEGG   Thermococcus litoralis: OCC_02245Help
Entry
OCC_02245         CDS       T02800                                 

Definition
(GenBank) glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00630  Glyoxylate and dicarboxylate metabolism
tlt01100  Metabolic pathways
tlt01110  Biosynthesis of secondary metabolites
tlt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCC_02245
Enzymes [BR:tlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     OCC_02245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: EHR79758
UniProt: Q9C4M5
Position
complement(152088..153083)
Genome map
AA seq 331 aa AA seqDB search
MKPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKE
LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV
EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS
RTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTS
RGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREGM
AELVAKNLIAFAKGEIPPNLVNKDVLTSSPP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaaggtgtttataacacgacaaattccggaaaatggaattaagatgattgag
aaattctatgaaatagaactctggaaagatccgaaggcacctccacggggagtgcttcta
gagaaagtcagagaggttgatgccttagtgacccttgtaacggacaaagtagataaagaa
ctactggaaaacgctccaaagttaaaaataatagcccaatatgcagtcggctatgataac
atagacatagaagaggctacaaaaaggggaatatacgttacaaacactcccggagtcctt
acggatgcaacggctgaccttgcatttgcccttcttctagcagttgcgaggagaattgta
gaggctgatgcctttgtgaggagtggcgaatggaagaaaagcgaagtcggctggcatcct
ctaatgtttctaggatatggattgaaaggaaagactttagggatagtgggctttggaaga
atcggccaggccctcgcaaagagagccaaagggttcgggatgaaaatcatctattactca
agaacacgtaaacctgaagcagaagaagagattggcgcagagtatgtggattttgaaacc
cttttgaaagagagcgactttataagccttcacgttcccctaaccaaagagacctaccac
atgataggagagaaggagctcaagcttatgaaacccaacgcaatcctaataaacacatct
agaggggcagttgtcgatactaatgccctaatcaaagcattaaaagaagggtggattgct
ggagcaggcttggatgtatttgaagaagaaccctactataacgaggagcttttcaagttg
aagaacgttgttttagctccccacataggcagcgcaactcatgaagcacgagaaggcatg
gcggagctggttgcaaagaacctaatagcatttgccaaaggtgaaatcccaccgaacctt
gtcaacaaagatgttctgacatcctccccgccgtga

DBGET integrated database retrieval system