KEGG   Thermococcus litoralis: OCC_11085Help
Entry
OCC_11085         CDS       T02800                                 

Definition
(GenBank) hypothetical protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00072  Synthesis and degradation of ketone bodies
tlt00280  Valine, leucine and isoleucine degradation
tlt00650  Butanoate metabolism
tlt00900  Terpenoid backbone biosynthesis
tlt01100  Metabolic pathways
tlt01110  Biosynthesis of secondary metabolites
tlt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OCC_11085
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    OCC_11085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCC_11085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCC_11085
Enzymes [BR:tlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     OCC_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III HMG_CoA_synt_N HMG_CoA_synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: EHR78494
UniProt: H3ZNH1
Position
1899590..1900642
Genome map
AA seq 350 aa AA seqDB search
MRRLLKPIKDVGIVGYGAYVPMYRIKNEEIGRVWGVSSFPIQEKSVNNLDEDAITIGIEA
ARNALKRAQIDPREIRALWFGTESKPYAVKPSATVIAEAIGATPDLDAADFEFACKAGTE
ALQAAIGFVGSGMAKYAMAIGADTSQGRPGDHLEFTASAGGAAYIVGEKSSETVAYFEGS
YSYVTDTPDFWRRQHEHYPRHGNRFTGEPAYFHQIISAAKGLMEELGYSPSDFDYAVFHQ
PNVKFPLTVAKILGIPKEKVLPGLLSGIIGNTYSGATLVGISAVLDIAKPGDRILWVSFG
SGAGSDAFSLVVQDAIEEKRDLAPKTMDYVNRKKYIDYALYAKHRGKYIL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagaagactgctgaagccaataaaggatgtcggaattgttggttatggtgcctatgta
ccaatgtatagaattaaaaacgaggagatcggaagggtttggggagtaagcagcttcccc
attcaggaaaagtccgtaaacaatttggatgaagatgccataacaatagggattgaagcg
gcaagaaatgcccttaaaagagctcaaatcgacccaagagaaattagggcattgtggttt
ggaaccgaatccaagccctatgctgttaagccttctgcaaccgttattgctgaggcaatt
ggggcaactccggatttagatgccgcagatttcgaatttgcatgtaaagccggaactgaa
gccttgcaagcagctatcggttttgttgggagtggaatggcaaaatatgcaatggcaatt
ggtgccgacacttctcaaggaagacctggtgatcacttagaatttactgcatccgccgga
ggagccgcttatatcgttggtgagaaaagctctgagacggttgcctattttgagggaagc
tattcctacgtaaccgacactccagatttctggagaagacagcacgagcactatccaagg
cacgggaataggttcactggagagcccgcttacttccaccagataataagcgccgcaaag
ggcttaatggaagagctgggctattcgccaagcgattttgactacgctgtcttccaccag
ccaaacgttaagtttccgctaacagtcgcaaagattctcggaatccccaaagaaaaagtc
cttccgggattgttaagtggaataataggaaacacatacagcggcgctacgttagttggc
atttcagcggttttggacatagcgaagccgggagacaggattctctgggtaagctttgga
agcggtgcgggtagcgatgcattcagcttagtggtgcaggatgcaattgaagaaaagaga
gacctagcgccaaagaccatggattacgtaaacaggaagaaatacatcgattatgcctta
tatgcaaagcacagaggtaagtacatcttgtga

DBGET integrated database retrieval system