KEGG   Thermococcus litoralis: OCC_14275Help
Entry
OCC_14275         CDS       T02800                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tlt  Thermococcus litoralis
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    OCC_14275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGT34333
UniProt: S5ZB97
Position
complement(1713074..1713655)
Genome map
AA seq 193 aa AA seqDB search
MKIAGAWVFSPILAGLFALILFRFYGRIINSIKSLGRIEFLYKWLAVLGGSYMAFNFGAN
EVANATGLLVGAGFFSPKTAGMFGALSLALGSLTFSYAVMYTVGKKITSLGPISAFSAQF
GSAIAVSLANMFGLPVSSSQAIVGGVVGVGLAAGRGVEKKVIWEIAFGWIATPTVSIALA
LGIFKLFQFSGLI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatagccggagcctgggtgttttcccctattttagcgggtttatttgccctgata
ctctttaggttttatggaaggataataaacagcattaaaagcttggggagaattgagttt
ctttacaagtggcttgctgttctcggaggatcctacatggcatttaactttggggcaaat
gaggtggcaaatgcaacgggtcttctcgttggggcaggcttctttagtccaaaaactgct
gggatgttcggggcgttaagtctagccttgggttctttaacgttcagctacgccgtaatg
tacacggtgggtaaaaagattacatccctcggccccatctcggctttttcagcccaattc
ggctcagctatagcggttagcttggcgaacatgtttgggctcccagttagctcaagccag
gctatagtgggaggagttgttggggtaggacttgcggcaggaaggggagtagagaagaaa
gttatatgggagatagcgtttggatggatcgctacaccaacagttagcatagccttagcc
ctcggaatcttcaagcttttccaattctcaggattaatttaa

DBGET integrated database retrieval system