KEGG   Thermotoga maritima MSB8: TM0025Help
Entry
TM0025            CDS       T00022                                 

Definition
(RefSeq) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00460  Cyanoamino acid metabolism
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM0025
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    TM0025
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     TM0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-GeneID: 896841
NCBI-ProteinID: NP_227841
UniProt: Q9WXN2 R4NZC1
Position
complement(23400..25565)
Genome map
AA seq 721 aa AA seqDB search
MERIDEILSQLTTEEKVKLVVGVGLPGLFGNPHSRVAGAAGETHPVPRLGIPAFVLADGP
AGLRINPTRENDENTYYTTAFPVEIMLASTWNRDLLEEVGKAMGEEVREYGVDVLLAPAM
NIHRNPLCGRNFEYYSEDPVLSGEMASAFVKGVQSQGVGACIKHFVANNQETNRMVVDTI
VSERALREIYLKGFEIAVKKARPWTVMSAYNKLNGKYCSQNEWLLKKVLREEWGFDGFVM
SDWYAGDNPVEQLKAGNDMIMPGKAYQVNTERRDEIEEIMEALKEGKLSEEVLDECVRNI
LKVLVNAPSFKGYRYSNKPDLESHAEVAYEAGAEGVVLLENNGVLPFDENTHVAVFGTGQ
IETIKGGTGSGDTHPRYTISILEGIKERNMKFDEELASTYEEYIKKMRETEEYKPRTDSW
GTVIKPKLPENFLSEKEIKKAAKKNDVAVVVISRISGEGYDRKPVKGDFYLSDDELELIK
TVSKEFHDQGKKVVVLLNIGSPIEVASWRDLVDGILLVWQAGQEMGRIVADVLVGKINPS
GKLPTTFPKDYSDVPSWTFPGEPKDNPQRVVYEEDIYVGYRYYDTFGVEPAYEFGYGLSY
TKFEYKDLKIAIDGETLRVSYTITNTGDRAGKEVSQVYIKAPKGKIDKPFQELKAFHKTK
LLNPGESEEISLEIPLRDLASFDGKEWVVESGEYEVRVGASSRDIRLRDIFLVEGEKRFK
P
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggatcgatgaaattctctctcagttaactacagaggaaaaggtgaagctcgtt
gtgggggttggtcttccaggactttttgggaacccacattccagagtggcgggtgcggct
ggagaaacacatcccgttccaagacttggaattcctgcgtttgtcctggcagatggtccc
gcaggactcagaataaatcccacaagggaaaacgatgaaaacacttactacacgacggca
tttcccgttgaaatcatgctcgcttctacctggaacagagaccttctggaagaagtggga
aaagccatgggagaagaagttagggaatacggtgtcgatgtgcttcttgcacctgcgatg
aacattcacagaaaccctctttgtggaaggaatttcgagtactactcagaagatcctgtc
ctttccggtgaaatggcttcagcctttgtcaagggagttcaatctcaaggggtgggagcc
tgcataaaacactttgtcgcgaacaaccaggaaacgaacaggatggtagtggacacgatc
gtgtccgagcgagccctcagagaaatatatctgaaaggttttgaaattgctgtcaagaaa
gcaagaccctggaccgtgatgagcgcttacaacaaactgaatggaaaatactgttcacag
aacgaatggcttttgaagaaggttctcagggaagaatggggatttgacggtttcgtgatg
agcgactggtacgcgggagacaaccctgtagaacagctcaaggccggaaacgatatgatc
atgcctgggaaagcgtatcaggtgaacacagaaagaagagatgaaatagaagaaatcatg
gaggcgttgaaggagggaaaattgagtgaggaggttctcgatgagtgtgtgagaaacatt
ctcaaagttcttgtgaacgcgccttccttcaaagggtacaggtactcaaacaagccggat
ctcgaatctcacgcggaagtcgcctacgaagcaggtgcggagggtgttgtccttcttgag
aacaacggtgttcttccgttcgatgaaaatacccatgtcgccgtctttggcaccggtcaa
atcgaaacaataaagggaggaacgggaagtggagacacccatccgagatacacgatctct
atccttgaaggcataaaagaaagaaacatgaagttcgacgaagaactcgcttccacttat
gaggagtacataaaaaagatgagagaaacagaggaatataaacccagaaccgactcttgg
ggaacggtcataaaaccgaaactcccagagaatttcctctcagaaaaagagataaagaaa
gctgcaaagaaaaacgatgttgcagttgttgtgatcagtaggatctccggtgagggatac
gacagaaagccggtgaaaggtgacttctacctctccgatgacgagctggaactcataaaa
accgtctcgaaagaattccacgatcagggtaagaaagttgtggttcttctgaacatcgga
agtcccatcgaagtcgcaagctggagagaccttgtggatggaattcttctcgtctggcag
gcgggacaggagatgggaagaatagtggccgatgttcttgtgggaaagattaatccctcc
ggaaaacttccaacgaccttcccgaaggattactcggacgttccatcctggacgttccca
ggagagccaaaggacaatccgcaaagagtggtgtacgaggaagacatctacgtgggatac
aggtactacgacaccttcggtgtggaacctgcctacgaattcggctacggcctctcttac
acaaagtttgaatacaaagatttaaaaatcgctatcgacggtgagacgctcagagtgtcg
tacacgatcacaaacactggggacagagctggaaaggaagtctcacaggtctacatcaaa
gctccaaaaggaaaaatagacaaacccttccaggagctgaaagcgtttcacaaaacaaaa
cttttgaacccgggtgaatcagaagaaatctccttggaaattcctctcagagatcttgcg
agtttcgatgggaaagaatgggttgtcgagtcaggagaatacgaggtcagggtcggtgca
tcttcgagggatataaggttgagagatatttttctggttgagggagagaagagattcaaa
ccatga

KEGG   Thermotoga maritima MSB8: TM0076Help
Entry
TM0076            CDS       T00022                                 

Definition
(RefSeq) xylosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00460  Cyanoamino acid metabolism
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM0076
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    TM0076
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     TM0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-GeneID: 896902
NCBI-ProteinID: NP_227892
UniProt: R4NX63 Q9WXT1
Position
78140..80476
Genome map
AA seq 778 aa AA seqDB search
MELYRDPSQPIEVRVRDLLSRMTLEEKVAQLGSVWGYELIDERGKFSREKAKELLKNGIG
QITRPGGSTNLEPQEAAELVNEIQRFLVEETRLGIPAMIHEECLTGYMGLGGTNFPQAIA
MASTWDPDLIEKMTTAVREDMRKIGAHQGLAPVLDVARDPRWGRTEETFGESPYLVARMG
VSYVKGLQGEDIKKGVVATVKHFAGYSASEGGKNWAPTNIPEREFKEVFLFPFEAAVKEA
NVLSVMNSYSEIDGVPCAANRKLLTDILRKDWGFEGIVVSDYFAVKVLEDYHRIARDKSE
AARLALEAGIDVELPKTECYQYLKDLVEKGIISEALIDEAVTRVLRLKFMLGLFENPYVE
VEKAKIESHRDIALEIARKSIILLKNDGILPLQKNKKVALIGPNAGEVRNLLGDYMYLAH
IRALLDNIDDVFGNPQIPRENYERLKKSIEEHMKSIPSVLDAFKEEGIEFEYAKGCEVTG
EDRSGFEEAIEIAKKSDVAIVVVGDKSGLTLDCTTGESRDMANLKLPGVQEELVLEVAKT
GKPVVLVLITGRPYSLKNVVDKVNAILQVWLPGEAGGRAIVDIIYGKVNPSGKLPISFPR
SAGQIPVFHYVKPSGGRSHWHGDYVDESTKPLFPFGHGLSYTKFEYSNLRIEPKEVPPAG
EVVIKVDVENIGDRDGDEVVQLYIGREFASVTRPVKELKGFKRVSLKAKEKKTVVFRLHM
DVLAYYNRDMKLVVEPGEFKVMVGSSSEDIRLTGSFSVVGEKREVVGMRKFFTEACEE
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtacagggatccttcgcaacccatcgaagtgagagtgagagatcttctttcc
agaatgacgctggaagagaaagtggcccagcttgggtctgtctggggttacgaactgata
gacgagaggggaaagttcagtagagaaaaagcaaaagaactcctcaaaaatggtataggc
cagatcacaaggcctggtggatcaacgaaccttgaacctcaagaagccgcggaacttgtg
aacgaaatacagagatttcttgtggaagaaacacgccttggaattcctgcgatgatacac
gaagaatgtctcaccggttacatgggacttggaggaaccaacttccctcaggcgatagca
atggcgagtacatgggatccagatctcatagaaaaaatgaccaccgccgtcagagaggat
atgagaaagataggggcacatcagggtctcgcacctgttctggatgtcgcaagagatcca
aggtgggggagaacagaagagacgttcggagaatctccctatctggtggcgaggatggga
gtctcttacgtgaaaggcctccagggggaagatatcaaaaaaggtgtcgttgccacagtg
aaacacttcgccggatacagcgcttctgaaggtggaaagaactgggcaccaacgaacatt
ccggagagggaattcaaagaggtctttctctttccgttcgaagcggccgttaaagaagcg
aatgtgctttctgtgatgaactcctacagcgaaatagacggtgtcccatgtgcagcgaac
aggaaactcctcacagacattctcagaaaagactggggattcgaaggaatcgtcgtttct
gactattttgctgtgaaagttctggaagattatcacagaatagcaagggataagtcagaa
gccgcaagactcgcacttgaagcggggatagatgttgaacttccgaagacagaatgttat
caatatttgaaagaccttgttgaaaaaggcatcatctccgaagctttgatcgacgaggca
gtcaccagggtgctgaggctgaagttcatgctcgggctcttcgaaaatccctacgttgag
gtggaaaaagcaaagatagaaagtcacagagacatcgcactcgagatagcaaggaaatcc
attatccttctcaagaatgatggaattctgcctcttcagaaaaacaaaaaagttgccctg
atcggaccgaacgcgggtgaggtgagaaatctcctcggagattacatgtaccttgcacac
ataagggctctcctcgacaacatagacgacgtctttggaaatcctcagatcccgagagaa
aactacgaaagactgaagaagagcatagaagaacatatgaagagcattccgagtgttctc
gatgccttcaaagaagaagggatcgaattcgaatatgcaaaaggctgtgaagtgacaggg
gaagacagaagcggtttcgaagaggcgatagaaattgcaaagaaatccgacgttgccatc
gttgtcgtaggggacaaatctggactcacccttgactgcacaaccggtgagtccagagac
atggcaaacctcaagcttccaggagtccaggaagaactcgtcctcgaagttgcaaagaca
ggaaaacccgtcgttcttgtcctcatcacgggaagaccctattcactcaaaaacgtcgtc
gacaaggtgaacgcgatccttcaggtgtggcttcctggagaagcgggaggaagagcgatc
gttgacatcatctatggaaaggtgaatccctctggaaaactcccgatcagctttccaaga
agcgctggtcagattcctgtcttccactacgtcaaaccatccgggggaaggtctcactgg
cacggagactacgtggatgagagcacaaagcctctcttcccgtttgggcacggtttgtct
tacacgaagttcgagtacagcaacctcagaatcgaaccgaaggaagtgccaccggccggc
gaagtggtgataaaggtggacgtggaaaacatcggagacagagacggagacgaggtggtt
caactttacatcggtcgtgagtttgcaagcgtcacaaggcctgtgaaagagctgaagggc
ttcaagagggtttctttgaaggcgaaagagaagaagactgttgtgttcaggcttcacatg
gacgtgctcgcctactacaacagagacatgaaactcgtggttgaacccggtgagttcaaa
gtgatggtgggaagctcttctgaagacatcagactcacaggttctttctccgtcgtcggt
gaaaaaagagaagtggtgggaatgaggaaattcttcacggaagcctgcgaggagtga

DBGET integrated database retrieval system