KEGG   Thermotoga maritima MSB8: TM0072
Entry
TM0072            CDS       T00022                                 

Name
(GenBank) oligopeptide ABC transporter, permease protein
  KO
K02033  peptide/nickel transport system permease protein
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tma00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM0072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tma02000]
    TM0072
Transporters [BR:tma02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    TM0072
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N FloA
Other DBs
NCBI-ProteinID: AAD35166
UniProt: Q9WXS7
Position
74266..75273
AA seq 335 aa
MSFVRRYLLPRLITYFLVVFVGLTIVFFLPRFLPSDPIQAYIDRLITQGGNLNPEYFNKL
VETIKELYGLQGSLWNQYVNFWKRLLKGDFGPSYFQFPTPVMKLIRQSLPWTAWLLFVTT
VISWIIGNILGGLAGYFSDKKWVKILDGIAMVIRPMPYYILALGLLILLAYIFPIFPIGG
GFAIGMKFTFSWENLLILLKHAFLPALSLVLIGVFSWFQAMKLVVQSVKTEDYVKYAKMG
GVEERRIVRRYVIRNAMLPQITGLALSLGQIFGGALITEIVFSYPGIGSLLYNAIFTGDY
NLLMGISTLSILLVTTSILVIDLLYPLFDPRVRYR
NT seq 1008 nt   +upstreamnt  +downstreamnt
ttgagctttgtaaggagatacctgcttccaagattgataacttactttctcgtagttttt
gtgggtttaacgattgtgtttttcttgccgagatttcttccgagcgatccaatacaggct
tacatcgatcgactcataacacagggaggaaatttgaatccagagtacttcaacaaactt
gtggaaacgatcaaggaactttatggtttgcagggaagcctgtggaatcagtacgtcaac
ttctggaaaagacttttaaaaggcgattttggtccttcatactttcagtttccaactcct
gtgatgaaattaataagacaatcactgccctggactgcctggctcttgtttgtaacgact
gtcatttcctggatcataggaaacattcttggaggactcgcaggatacttctctgacaaa
aaatgggtgaagattctcgatggtattgcgatggtgataagaccgatgccgtactacatc
ctcgcactcggacttttgatcctacttgcgtatatattccccatctttccaatcggcgga
ggttttgcaataggaatgaaattcaccttcagctgggaaaacctgctgatactcctaaaa
catgctttccttccagctctttctttagttctaataggtgtgttttcctggtttcaagcc
atgaagcttgtggttcaaagtgtgaaaacagaagactacgtgaaatacgcaaagatggga
ggagtagaggagagaagaatcgttcgaagatatgtcataagaaacgctatgttaccacag
ataacgggtcttgctctctctctgggacagatctttggaggtgctttgatcacagagatc
gtgttctcctatcccggtattggatctctcctttataatgccattttcacaggtgattac
aatctactgatgggtataagtaccctctccatacttctcgtcacaaccagtatactcgtt
atagacctgctgtatccacttttcgatccaagggtgagatacagatga

DBGET integrated database retrieval system