KEGG   Thermotoga maritima MSB8: TM0138Help
Entry
TM0138            CDS       T00022                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00260  Glycine, serine and threonine metabolism
tma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01130  Biosynthesis of antibiotics
tma01230  Biosynthesis of amino acids
Module
tma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM0138
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0138
Enzymes [BR:tma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-GeneID: 896968
NCBI-ProteinID: NP_227953
UniProt: P50909 G4FH52
Position
complement(143534..144703)
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEEIMKDESFWKEFNDLLRDYAGRPTPLYFARR
LSEKYGARIYLKREDLLHTGAHKINNAIGQVLLAKKMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttacttcggtccttacggaggtcagtacgttcccgagattctcatgcccgca
ctcgaggaacttgaggcggcttacgaggaaatcatgaaggatgaatcgttctggaaagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttactttgccagaagg
ttgagtgaaaagtacggtgccaggatctatttgaagcgcgaagatcttcttcacacaggc
gctcacaagataaacaacgccataggtcaggtgcttctcgcaaaaaagatgggaaaaaca
agaataatagcggaaacaggagcgggacagcacggtgttgccactgcaacggctgccgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaacct
aacgttgagaggatgaaacttctcggtgcgaaagtggtccctgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagctcttcgggactggatcacgaaccttcagaccacc
tactacgtcattggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgcgttggaggaggaagcaacgccgccggtatattctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaagatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacatgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataagatga

DBGET integrated database retrieval system