KEGG   Thermotoga maritima MSB8: TM0296Help
Entry
TM0296            CDS       T00022                                 

Definition
(RefSeq) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00051  Fructose and mannose metabolism
tma00500  Starch and sucrose metabolism
tma00520  Amino sugar and nucleotide sugar metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TM0296
   00500 Starch and sucrose metabolism
    TM0296
   00520 Amino sugar and nucleotide sugar metabolism
    TM0296
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     TM0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 897221
NCBI-ProteinID: NP_228108
UniProt: Q9WYD2 R4NNB2
Position
complement(314141..315088)
Genome map
AA seq 315 aa AA seqDB search
MNVLCTGEILIDFISEDKGKNLSQSELFRKKAGGSPLNVAVALKRLGREVSFLGKLGGDQ
FSEFLLEVMKKEGIDTTHIIFDSSCKTTLAFVARDAQGNPDFVFFREKPADTNLRPEEVN
IDPAQFSFLHIGSYSLAVEPSRSAYLKVMETFLEEGKPVSYDPNVRPSLIEDRNTFVKDF
LEISSKVDIVKLSDKDLEYIFQEDLETAVDKIPIKENGLLFVTMGERGCLVKFKGEKRMV
PSFKVKPVDATGCGDSFTAAVIHKYLEKTPETIEDAVEIGKFANAVAAIVITRVGGVDAM
PVLDEVEMFLSNQER
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttctctgcaccggtgaaatcctcattgatttcatctcagaggacaaaggaaag
aacctttcacagagtgagctcttcagaaagaaagcgggaggttctcccctgaacgtcgcc
gttgctctcaaaagactgggaagagaggtttcttttctcggaaaacttggaggagaccag
ttctccgagttcctacttgaggtgatgaaaaaagaaggcatagacacaacacacatcatc
ttcgattcttcttgtaagactaccctcgcttttgtggcaagagacgctcagggaaatccg
gatttcgtcttcttcagagaaaaaccagccgatacgaatctgagaccggaagaagtgaac
atcgaccccgcacaattttctttccttcacatcggatcatactctcttgccgttgaacca
tcgagaagcgcctatttgaaagtgatggaaacgtttttggaagaagggaagcccgtctct
tacgatccgaacgtgagaccctcactgatagaagacagaaacaccttcgtgaaggacttt
ctcgagatctcttcgaaggtagatatcgtaaaactcagcgacaaggatctggaatacatc
ttccaggaagatttagaaacggccgttgacaaaattccgatcaaggaaaacggcctgctt
tttgtgaccatgggagaaaggggatgtcttgtgaagttcaaaggagaaaaacgtatggtt
ccttctttcaaagtaaaacctgtggatgccacggggtgcggagactcgttcacagccgct
gtgatacacaagtatctggagaaaacacctgaaacgatcgaagacgctgtcgagatagga
aagttcgccaacgccgtcgccgctatcgttatcacaagagtaggcggtgtagatgctatg
ccggtgttagatgaagttgaaatgtttctatcaaatcaggaacgttga

DBGET integrated database retrieval system