KEGG   Thermotoga maritima MSB8: TM0343Help
Entry
TM0343            CDS       T00022                                 

Definition
(RefSeq) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01130  Biosynthesis of antibiotics
tma01230  Biosynthesis of amino acids
Module
tma_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0343
Enzymes [BR:tma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     TM0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB PEP_mutase
Motif
Other DBs
NCBI-GeneID: 897299
NCBI-ProteinID: NP_228154
UniProt: Q9WYH8 G4FHQ5
Structure
PDB: 

Position
361173..362189
Genome map
AA seq 338 aa AA seqDB search
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVE
SVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSVEGREMLMETAHFLSEL
GVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPKVAEYADI
IQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIR
TFEKATRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGAHGIIVEVH
PEPEKALSDGKQSLDFELFKELVQEMKKLADALGVKVN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcgttttgaaacccggttccacagaagaagatataaggaaggtggtgaagttg
gccgagagttacaacttgaagtgtcacatttccaaaggtcaggaaagaacggttattggg
atcatcggggacgacaggtacgtggtggcggacaagttcgagtcgctggattgcgtggaa
agcgttgtgagggtgctcaaaccttacaaactcgtttctcgtgagttccatccggaggac
acggtgatcgacctcggagatgtgaagataggaaacggctacttcaccatcatagcggga
ccgtgctcagttgaaggcagggaaatgctcatggaaaccgcacactttttaagcgaactc
ggtgttaaagttttgaggggaggggcctacaagcctcgaacatctccttactctttccaa
ggactcggagaaaaggggctggaatacctgagagaggctgccgacaagtacggtatgtac
gtggtgacggaggctctcggagaagacgatcttccaaaagtggccgagtacgctgatatc
attcagataggagcgagaaacgctcagaacttcagattgctctctaaagcgggaagctac
aacaaacccgttcttctgaaaaggggtttcatgaacaccatcgaagagttccttctctcc
gctgaatacattgcaaactctggaaacacgaagatcatactgtgtgaaaggggaatcaga
acgttcgaaaaggccacgaggaacacactcgatatatccgctgttcctataatcagaaag
gaatcccatcttcccattctggtggatccgagccactctgggggaagaagagacctcgtt
attccactctcccgggccgctatagcggttggagctcatggaatcattgtggaggttcat
ccggagccggagaaggcactttcggatggaaaacagagtcttgacttcgagctcttcaag
gaactggttcaggaaatgaagaaactcgctgatgccctgggggtgaaggtgaattga

DBGET integrated database retrieval system