KEGG   Thermotoga maritima MSB8: TM0364Help
Entry
TM0364            CDS       T00022                                 

Definition
(RefSeq) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM0364
Enzymes [BR:tma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TM0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1945
Motif
Other DBs
NCBI-GeneID: 897323
NCBI-ProteinID: NP_228175
UniProt: P80099 G4FHS6
Structure
PDB: 

Position
382025..383350
Genome map
AA seq 441 aa AA seqDB search
MIGYQIYVRSFRDGNLDGVGDFRGLKNAVSYLKELGIDFVWLMPVFSSISFHGYDVVDFY
SFKAEYGSEREFKEMIEAFHDSGIKVVLDLPIHHTGFLHTWFQKALKGDPHYRDYYVWAN
KETDLDERREWDGEKIWHPLEDGRFYRGLFGPFSPDLNYDNPQVFDEMKRLVLHLLDMGV
DGFRFDAAKHMRDTIEQNVRFWKYFLSDLKGIFLAEIWAEARMVDEHGRIFGYMLNFDTS
HCIKEAVWKENTRVLIESIERAVIGKDYLPVNFTSNHDMSRLASFEGGFSKEKIKLSISI
LFTLPGVPLVFYGDELGMKGVYQKPNTEVVLDPFPWNESMCVEGQTFWKWPAYNGPFSGI
SVEYQKRDPDSILSHTLGWTRFRKENQWIDRAKLEFLCKEDKFLVYRLYDDQHSLKVFHN
LSGEEVVFEGVKMKPYKTEVV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgataggctatcagatctacgtgagatctttcagggatggaaacctcgacggtgtggga
gatttcaggggattgaaaaacgctgtttcctacctgaaagaactggggattgactttgtc
tggctcatgcctgttttttcctccatatcttttcacgggtacgacgtggtggatttttat
tctttcaaagctgagtacggtagtgagagagagttcaaagagatgatcgaggcattccac
gacagcggaataaaagtcgttcttgaccttcccatccatcacacaggctttctccacacg
tggttccagaaggcgctgaaaggagatccacactacagagattactacgtatgggcaaac
aaagagacggatctggacgaaagaagagagtgggatggagaaaagatctggcatcccctg
gaagatgggaggttctacagagggctctttggacctttctcacccgacttgaactacgac
aacccgcaggtattcgatgaaatgaaaagactggttctccaccttctcgatatgggagtg
gatggtttcaggttcgatgcagcaaagcacatgagagatacgatcgaacagaatgttcgc
ttctggaagtactttctttccgatttgaagggcatcttcctcgcagagatatgggcagag
gccagaatggtggatgaacacggcagaatatttggctacatgctcaactttgacacatcc
cactgtataaaggaagctgtatggaaagagaacacaagagttctgatagagtcgatcgaa
agggccgttatcggcaaagactacctcccggtgaattttacttcgaatcacgacatgtcg
aggcttgcaagctttgaaggaggcttcagcaaagaaaagatcaaactttcgatttccatt
cttttcactctcccgggagttcctctcgtgttctatggggatgagcttggaatgaaggga
gtttaccagaaaccgaacacagaagtcgtcctggatccgttcccgtggaacgagagtatg
tgcgttgagggacagaccttctggaagtggcccgcgtacaacgggcctttctctggtatc
tccgtagaataccagaagagagatcccgattcgattctttcacacactctgggatggacg
agattcagaaaggaaaaccagtggatcgatcgggcaaagctcgaatttttgtgtaaagag
gacaagtttcttgtgtacagactctacgatgatcagcattctttgaaggtgtttcacaat
ctttcaggggaagaggttgtctttgagggagttaaaatgaagccttacaaaacggaggtg
gtttga

KEGG   Thermotoga maritima MSB8: TM1845Help
Entry
TM1845            CDS       T00022                                 

Definition
(RefSeq) pullulanase
  KO
K01200  pullulanase [EC:3.2.1.41]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM1845
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     TM1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PUD CBM_48 Alpha-amylase DUF3372 GHL10
Motif
Other DBs
NCBI-GeneID: 897812
NCBI-ProteinID: NP_229641
UniProt: O33840 G4FGN0
Structure
PDB: 

Position
1822642..1825173
Genome map
AA seq 843 aa AA seqDB search
MKTKLWLLLVLLLSALIFSETTIVVHYHRYDGKYDGWNLWIWPVEPVSQEGKAYQFTGED
DFGKVAVVKLPMDLTKVGIIVRLNEWQAKDVAKDRFIEIKDGKAEVWILQGVEEIFYEKP
DTSPRIFFAQARSNKVIEAFLTNPVDTKKKELFKVTVDGKEIPVSRVEKADPTDIDVTNY
VRIVLSESLKEEDLRKDVELIIEGYKPARVIMMEILDDYYYDGELGAVYSPEKTIFRVWS
PVSKWVKVLLFKNGEDTEPYQVVNMEYKGNGVWEAVVEGDLDGVFYLYQLENYGKIRTTV
DPYSKAVYANSKKSAVVNLARTNPEGWENDRGPKIEGYEDAIIYEIHIADITGLENSGVK
NKGLYLGLTEENTKGPGGVTTGLSHLVELGVTHVHILPFFDFYTGDELDKDFEKYYNWGY
DPYLFMVPEGRYSTDPKNPHTRIREVKEMVKALHKHGIGVIMDMVFPHTYGIGELSAFDQ
TVPYYFYRIDKTGAYLNESGCGNVIASERPMMRKFIVDTVTYWVKEYHIDGFRFDQMGLI
DKKTMLEVERALHKIDPTIILYGEPWGGWGAPIRFGKSDVAGTHVAAFNDEFRDAIRGSV
FNPSVKGFVMGGYGKETKIKRGVVGSINYDGKLIKSFALDPEETINYAACHDNHTLWDKN
YLAAKADKKKEWTEEELKNAQKLAGAILLTSQGVPFLHGGQDFCRTKNFNDNSYNAPISI
NGFDYERKLQFIDVFNYHKGLIKLRKEHPAFRLKNAEEIKKHLEFLPGGRRIVAFMLKDH
AGGDPWKDIVVIYNGNLEKTTYKLPEGKWNVVVNSQKAGTEVIETVEGTIELDPLSAYVL
YRE
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgaagactaaactctggttgttacttgttctcctcctttccgctttgatattctcagaa
accaccatcgtagtccactatcacagatacgatggaaaatacgatggatggaatctctgg
atatggcccgtggagcctgtgtctcaggaagggaaagcttatcagttcacaggtgaggat
gattttggtaaagtagcagtagtgaaattaccaatggatcttacaaaggtggggatcata
gtgaggctgaacgagtggcaggcaaaagacgtggcaaaagacaggttcatagagataaaa
gacggaaaggctgaagtgtggatactccagggagtggaagagattttctacgaaaaacca
gacacatctcccagaatcttcttcgcacaggcaaggtcgaacaaggtgatcgaggctttt
ctgaccaatcctgtggatacgaaaaagaaagaactcttcaaggttactgttgacggaaaa
gagattcccgtctcaagagtggaaaaggccgatcccacggacatagacgtgacgaactac
gtgagaatcgtcctttctgaatccctgaaagaagaagacctcagaaaagacgtggaactg
atcatagaaggttacaaaccggcaagagtcatcatgatggagatcctggacgactactat
tacgatggagagctcggagccgtatattctccagagaagacgatattcagagtctggtcc
cccgtttctaagtgggtaaaggtgcttctcttcaaaaacggagaagacacagaaccgtac
caggttgtgaacatggaatacaagggaaacggggtctgggaagcggttgttgaaggcgat
ctcgacggagtgttctacctctatcagctggaaaactacggaaagatcagaacaaccgtc
gatccttattcgaaagcggtttacgcaaacagcaaaaagagcgccgttgtgaatcttgcc
aggacaaacccagaaggatgggaaaacgacaggggaccgaaaatcgaaggatacgaagac
gcgataatctatgaaatacacatagcggacatcacaggactcgaaaactccggggtaaaa
aacaaaggcctctatctcgggctcaccgaagaaaacacgaaaggaccgggcggtgtgaca
acaggcctttcgcaccttgtggaactcggtgttacacacgttcatatacttcctttcttt
gatttctacacaggcgacgaactcgataaagatttcgagaagtactacaactggggttac
gatccttacctgttcatggttccggagggcagatactcaaccgatcccaaaaacccacac
acgagaatcagagaagtcaaagaaatggtcaaagcccttcacaaacacggtataggtgtg
attatggacatggtgttccctcacacctacggtataggcgaactctctgcgttcgatcag
acggtgccgtactacttctacagaatcgacaagacaggtgcctatttgaacgaaagcgga
tgtggtaacgtcatcgcaagcgaaagacccatgatgagaaaattcatagtcgataccgtc
acctactgggtaaaggagtatcacatagacggattcaggttcgatcagatgggtctcatc
gacaaaaagacaatgctcgaagtcgaaagagctcttcataaaatcgatccaactatcatt
ctctacggcgaaccgtggggtggatggggagcaccgatcaggtttggaaagagcgatgtc
gccggcacacacgtggcagctttcaacgatgagttcagagacgcaataaggggttccgtg
ttcaacccgagcgtcaagggattcgtcatgggaggatacggaaaggaaaccaagatcaaa
aggggtgttgttggaagcataaactacgacggaaaactcatcaaaagtttcgcccttgat
ccagaagaaactataaactacgcagcgtgtcacgacaaccacacactgtgggacaagaac
taccttgccgccaaagctgataagaaaaaggaatggaccgaagaagaactgaaaaacgcc
cagaaactggctggtgcgatacttctcacttctcaaggtgttcctttcctccacggaggg
caggacttctgcaggacgaagaatttcaacgacaactcctacaacgcccctatctcgata
aacggcttcgattacgaaagaaaacttcagttcatagacgtgttcaattaccacaagggt
ctcataaaactcagaaaagaacaccctgctttcaggctgaaaaacgctgaagagatcaaa
aaacacctggaatttctcccgggcgggagaagaatagttgcgttcatgcttaaagaccac
gcaggtggtgatccctggaaagacatcgtggtgatttacaatggaaacttagagaagaca
acatacaaactgccagaaggaaaatggaatgtggttgtgaacagccagaaagccggaaca
gaagtgatagaaaccgtcgaaggaacaatagaactcgatccgctttccgcgtacgttctg
tacagagagtga

DBGET integrated database retrieval system