KEGG   Thermotoga maritima MSB8: TM0392Help
Entry
TM0392            CDS       T00022                                 

Definition
(RefSeq) hypothetical protein
  KO
K13057  trehalose synthase [EC:2.4.1.245]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM0392
Enzymes [BR:tma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.245  alpha,alpha-trehalose synthase
     TM0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 897379
NCBI-ProteinID: NP_228202
UniProt: R4NY22 Q9WYM3
Position
411580..412800
Genome map
AA seq 406 aa AA seqDB search
MDVVLRERSIEEYRTIIGNEVDEIKKLAEPLKGKKVLHVNATAYGGGVAEILHNLVPLMR
SVGLDARWRVIEAPDEFFNVTKKFHNTLQGADIEISEEEWNLYEEVCRKNAELIQDEELF
VIHDSQPAAVRKFVDLNDRKWIWRCHIDLSTPNMKVWQKFSQYLEGYNRLVFHLEEYFPQ
GWKERSIAFPPSIDPLSEKNRDLDEDTIRKTLERLEIDPERPLITVVARFDPWKDLFSAI
DVYRLVKKEIPEVQLAVVSAMAADDPEGWFFFEKVLRYAGTDEDIKFCTNLKGVGNKEVN
AIQRATTVALHTATREGFGLVISEALYKRVPVVARPVGGVKIQVKHGENGYLAWEREDLA
GYVVKLIKDEELRRKMGEKGRQTVVENFIITVHLKNYLKLFLDLLR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtggatgttgtgttgagagagcgaagcatagaggagtaccgcaccataatcggaaacgag
gtggacgagataaaaaaactcgcagaacctcttaaaggaaaaaaggtgctccacgtcaat
gcgactgcctacggtggaggagttgctgaaattctccacaatctcgttccgcttatgaga
tcggttggtctggatgccagatggagggtcatagaggcacccgatgagttcttcaatgtc
acaaaaaagtttcacaacacgcttcagggagcagatatagagatttcagaggaagaatgg
aacctttacgaagaggtctgcagaaaaaacgcagaactgatccaggatgaagagttattc
gtgatccacgattcccaaccagcagctgtgagaaagtttgtggatttgaacgacaggaag
tggatctggagatgtcatatagatctatccactccaaacatgaaggtctggcaaaaattt
tctcagtatctggaaggatacaacagactcgttttccatctcgaggagtatttcccgcag
ggatggaaagaaaggagcattgcttttccaccgagtatagaccccctgagtgaaaagaat
cgagatcttgacgaagacacgataagaaaaactcttgaaagactcgaaatagacccggag
agacctctgataactgttgtggctcgatttgatccgtggaaagatctcttcagtgccatc
gacgtctatagactggtgaagaaagagatcccggaggttcagcttgccgtggtttccgcc
atggcggcggacgatccagaaggatggttcttctttgagaaggtcctcagatacgccgga
acggacgaagatataaaattctgcacgaacctgaaaggtgttggaaacaaggaagtgaac
gctattcagagggccacaaccgttgctcttcacacggcaacaagagaaggctttggtctc
gtcataagtgaagccctttacaagagggttccggtcgtggcaaggccagttggtggtgtt
aagatacaggtgaaacatggagaaaatggttatttggcatgggaaagagaagaccttgcg
gggtacgtggtaaaactcataaaggatgaagaactcagaagaaaaatgggagaaaaagga
aggcaaaccgtggtggaaaatttcattatcacggtgcatctgaagaactatctgaaactc
ttcttagatctgttgaggtga

DBGET integrated database retrieval system