KEGG   Thermotoga maritima MSB8: TM0452
Entry
TM0452            CDS       T00022                                 

Definition
(GenBank) preprotein translocase SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM0452
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM0452
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM0452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM0452
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM0452
SSDB
Motif
Pfam: SecE YukC
Other DBs
NCBI-ProteinID: AAD35535
UniProt: P35874
Structure
PDB: 
3DIN

Position
474652..474849
AA seq 65 aa
MEKLRKFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLDFIFSGVVSAIFK
ALGIG
NT seq 198 nt   +upstreamnt  +downstreamnt
atggagaaactccgaaagttcttcagggaagtcatcgccgaagcaaagaaaatttcctgg
ccctcccgaaaggagttgctcacttcttttggtgttgttctcgtgatactcgctgttaca
agtgtttatttttttgtgcttgatttcatcttctcgggagttgtgagtgcgattttcaaa
gcgctgggaataggataa

DBGET integrated database retrieval system