KEGG   Thermotoga maritima MSB8: TM0859
Entry
TM0859            CDS       T00022                                 

Definition
(GenBank) hypothetical protein
  KO
K03210  preprotein translocase subunit YajC
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM0859
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM0859
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM0859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM0859
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM0859
SSDB
Motif
Pfam: YajC MS_channel Chromate_transp DUF2208 ATG27 DUF4131 MreC Peptidase_A8 Arteri_nsp7a T2SSM
Other DBs
NCBI-ProteinID: AAD35941
UniProt: Q9WZW3
Position
883332..883682
AA seq 116 aa
MPEIIYAAAPGASNGTTTTATGGGWGSLLFMLIFFIAIFYFMIILPQRRREKQFQQMISQ
MKRGDTVVTIGGIVGKVIDIKKDTVKIKTANSTELEITKRAISTVIKERSQENQEG
NT seq 351 nt   +upstreamnt  +downstreamnt
atgcctgagatcatctacgcagcagctccgggtgcttcgaacggtaccaccacaaccgca
acaggtggtggctggggaagtctcctcttcatgctgatattcttcatagccattttttac
ttcatgatcatccttccccagaggagaagagaaaaacagttccagcagatgataagtcag
atgaaacgaggagacacggtcgtcacaatcggaggaattgtcgggaaagtcatcgatatc
aaaaaggacaccgtcaagatcaaaacagcaaattccacggaactcgagataacaaaaagg
gctatttccacggttataaaggagaggtcacaggaaaatcaggagggatga

DBGET integrated database retrieval system